Ctenocephalides felis (cat flea): 113386737 Help Entry 113386737         CDS       T08578                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism cfel  Ctenocephalides felis (cat flea) Pathway cfel04070   Phosphatidylinositol signaling system cfel04745   Phototransduction - fly Brite KEGG Orthology (KO) [BR:cfel00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     113386737  09150 Organismal Systems   09157 Sensory system    04745 Phototransduction - fly     113386737  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cfel01009]     113386737   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfel04131]     113386737    03036 Chromosome and associated proteins [BR:cfel03036]     113386737   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfel04147]     113386737 Protein phosphatases and associated proteins [BR:cfel01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      113386737 Membrane trafficking [BR:cfel04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     113386737 Chromosome and associated proteins [BR:cfel03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      113386737 Exosome [BR:cfel04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    113386737 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_8 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 AIF-1 EF-hand_9 EF-hand_11 EF_EFCAB10_C EH DUF5580_M EFhand_Ca_insen SPARC_Ca_bdg Dockerin_1 UPF0154 Motif Other DBs NCBI-GeneID:  113386737 NCBI-ProteinID:  XP_026480282 LinkDB All DBs Position Unknown AA seq 77 aa AA seqDB search MLIIGTVANTEEEVREAFRVFDRAGNGIISAAELRHIMTNLGEKLTQEEVDEMIREADID GDGQINYEEFVTMMMAK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgttgataattggtaccgtagccaacacagaagaagaagtacgggaagctttccgggtt ttcgaccgtgccggaaatggtataatttctgcggcagaacttcggcacattatgaccaat ttgggcgaaaagttgacccaagaagaagttgatgaaatgattagagaagccgatatcgat ggcgatggacagattaattatgaagaattcgttactatgatgatggccaaataa

DBGET integrated database retrieval system