Clostridium fermenticellae: D4Z93_05705 Help Entry D4Z93_05705       CDS       T06956                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cfer  Clostridium fermenticellae Pathway cfer01100   Metabolic pathways cfer01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cfer00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D4Z93_05705    00074 Mycolic acid biosynthesis     D4Z93_05705   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D4Z93_05705 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  AYD40036 UniProt:  A0A386H2Y1 LinkDB All DBs Position 1184156..1184389 Genome browser AA seq 77 aa AA seqDB search MIFEKVKSIIAEQLGIDEGEITMESSFVDDLGADSLDVVELIMALETEFNLEIPDEDAEK VTIVGDIVDYIKAHTEE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtgatatttgaaaaggttaaaagtataatagcggaacagcttggtattgatgaaggagaa attactatggaatcatcatttgttgatgatttaggtgctgattctttagatgtagttgaa ttgataatggctctggaaacagagtttaatttggaaatacctgatgaggatgctgaaaaa gtaactattgttggggatatagttgattacataaaagctcatacagaagagtaa

DBGET integrated database retrieval system