Caulobacter flavus: C1707_16640 Help Entry C1707_16640       CDS       T05702                                  Name (GenBank) Flp family type IVb pilin   KO K02651   pilus assembly protein Flp/PilA Organism cfh  Caulobacter flavus Pathway cfh02020   Two-component system cfh04112   Cell cycle - Caulobacter Brite KEGG Orthology (KO) [BR:cfh00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     C1707_16640  09140 Cellular Processes   09143 Cell growth and death    04112 Cell cycle - Caulobacter     C1707_16640  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:cfh02044]     C1707_16640    02035 Bacterial motility proteins [BR:cfh02035]     C1707_16640 Secretion system [BR:cfh02044]  Type II secretion system   Tight adherence (Tad) export apparatus    C1707_16640 Bacterial motility proteins [BR:cfh02035]  Pilus system   Pilus assembly proteins    C1707_16640 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DUF4244 Flp_Fap Motif Other DBs NCBI-ProteinID:  AYV47756 UniProt:  A0A2N5CTH0 LinkDB All DBs Position complement(3646755..3646937) Genome browser AA seq 60 aa AA seqDB search MNTLRELIFEEDGAAAAEYALILAIIGSAIAVAAVLLGTNIGTAITDAATCVANPSAANC NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atgaatactctgcgtgaactgatcttcgaggaagacggcgcggccgcggccgaatacgcc ctgatcctggccatcatcggcagcgccatcgccgtcgcggcggtgctgctgggcaccaac atcgggaccgccatcacggacgccgccacctgcgtggccaatccgtcggccgcgaactgc tga

DBGET integrated database retrieval system