KEGG   Cellulomonas fimi: Celf_0942
Entry
Celf_0942         CDS       T01490                                 
Name
(GenBank) NADH-ubiquinone/plastoquinone oxidoreductase chain 6
  KO
K00339  NADH-quinone oxidoreductase subunit J [EC:7.1.1.2]
Organism
cfi  Cellulomonas fimi
Pathway
cfi00190  Oxidative phosphorylation
cfi01100  Metabolic pathways
Module
cfi_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cfi00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Celf_0942
Enzymes [BR:cfi01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     Celf_0942
SSDB
Motif
Pfam: Oxidored_q3 DUF4534 S_layer_C CytochromB561_N
Other DBs
NCBI-ProteinID: AEE45079
UniProt: F4H1A8
LinkDB
Position
1034348..1035325
AA seq 325 aa
MSALALAAAPLTTATLDADGLAGTGETVLFWVLAPIMVLAALGLLFARKAVHAALAVVVV
MISLAFLYVAQDAVFLGVVQVVVYTGAVMMLFLFVLMLVGVDASDSLVETIRGQRWIGAL
AGIGLGVVLAGVVGRAAYGPSQGLDSANEASNPVAIAHLVFGEYVLAFEVVGALLVTAAL
GALVYTHRTRLTPRVGQKERADARVAAGAHPVSLPAPGVYARHNAMDVPALGPDGQPIEN
SVPRVLRVRGQEADAAEFAARIERVLAGGSADARDLVGDEPTPPPAAHPEGAPVGVPDVD
AAVSDSGQHGPSTGPGGVAGQEDRA
NT seq 978 nt   +upstreamnt  +downstreamnt
gtgagcgccctggccctcgccgcggccccgctgacgaccgcgacgctcgacgccgacggg
ctcgccggcaccggcgagaccgtcctgttctgggtgctcgcgccgatcatggtgctcgcc
gcgctcgggctgctgttcgcgcgcaaggcggtgcacgcggccctggcggtcgtcgtcgtg
atgatctccctggcgttcctctacgtcgcgcaggacgcggtgttcctcggggtcgtgcag
gtcgtggtctacaccggcgccgtgatgatgctgttcctgttcgtcctcatgctcgtcggc
gtcgacgcgtccgactcgctcgtcgagacgatccgcgggcagcgctggatcggcgcgctc
gccggcatcggcctgggcgtcgtcctcgcgggcgtcgtcggccgcgccgcgtacgggccc
tcgcagggcctggacagcgcgaacgaggcgtccaaccccgtcgcgatcgcgcacctcgtc
ttcggcgagtacgtgctcgcgttcgaggtcgtgggagcgctgctggtgaccgcggcgctc
ggcgcgctcgtctacacgcaccggacgcggctcacgccgcgcgtgggccagaaggagcgc
gccgacgcgcgtgtcgccgcgggggcgcaccccgtctcgctgccggcaccgggcgtgtac
gcgcggcacaacgcgatggacgtccccgcgctcgggcccgacgggcagccgatcgagaac
tccgtgccgcgcgtgctgcgtgtgcgcgggcaggaggccgacgccgccgagttcgccgcc
cgcatcgagcgcgtgctcgcgggcgggtcggcggacgcgcgggacctcgtcggcgacgag
cccacgccgccgcccgcggcccacccggagggcgcgccggtcggcgtgcccgacgtggac
gccgccgtgagcgacagcggtcagcacggaccgtcgaccggacccggcggggtcgccgga
caggaggaccgggcgtga

DBGET integrated database retrieval system