Cellulomonas fimi: Celf_2804 Help Entry Celf_2804         CDS       T01490                                  Name (GenBank) ATP synthase F0, C subunit   KO K02110   F-type H+-transporting ATPase subunit c Organism cfi  Cellulomonas fimi Pathway cfi00190   Oxidative phosphorylation cfi01100   Metabolic pathways Module cfi_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:cfi00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Celf_2804  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:cfi00194]     Celf_2804 Photosynthesis proteins [BR:cfi00194]  Photosystem and electron transport system   F-type ATPase [OT]    Celf_2804 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DoxX_2 Motif Other DBs NCBI-ProteinID:  AEE46928 UniProt:  F4H7G7 LinkDB All DBs Position complement(3133102..3133353) Genome browser AA seq 83 aa AA seqDB search MALADTSTILAAADAVSGNIATVGYGLAVIGPGIGLGILIGKTIEGIARQPEVAGQLRTT MFIGIGFVEVLGLLGLITGFLFP NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtggctcttgcggacaccagcaccatcctcgcggcggcggacgccgtctcgggcaacatc gcgaccgtcggctacggcctcgccgtcatcggtcccggtatcggcctgggcatcctcatc ggcaagaccatcgagggcatcgcacgccagcccgaggtggccggccagctgcgcaccacg atgttcatcggtatcggcttcgtcgaggtcctcggcctcctcggcctcatcacgggcttc ctcttcccgtga

DBGET integrated database retrieval system