Colletotrichum fioriniae: CFIO01_03355 Help Entry CFIO01_03355      CDS       T04796                                  Name (GenBank) RNA polymerase Rpb6   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism cfj  Colletotrichum fioriniae Pathway cfj03020   RNA polymerase cfj03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cfj00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     CFIO01_03355   09124 Replication and repair    03420 Nucleotide excision repair     CFIO01_03355  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cfj03021]     CFIO01_03355    03400 DNA repair and recombination proteins [BR:cfj03400]     CFIO01_03355 Transcription machinery [BR:cfj03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      CFIO01_03355   RNA polymerase III system    RNA polymerase III      CFIO01_03355   RNA polymerase I system    RNA polymerase I      CFIO01_03355 DNA repair and recombination proteins [BR:cfj03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       CFIO01_03355 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-ProteinID:  EXF78698 UniProt:  A0A010S2A0 LinkDB All DBs AA seq 153 aa AA seqDB search MSDFGDDDVGGGDETMYEDEAADYWDPEVPADDEEVGRAEGDEEDADNVVASGDPSAAAN AGKGNEKSHRDKKIPDDQRTTTPYMTKYERARILGTRALQISMNAPVLVDLEGETDPLQI AIKELREKKIPLIVRRYMPDGYYEDWTCEELLQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgtctgacttcggcgatgacgatgttggcggaggcgacgagaccatgtacgaggacgag gctgctgactactgggatcccgaggttcctgcggacgacgaggaagttggaagagcagag ggcgacgaggaggacgcggacaatgtcgttgcatcgggtgacccctctgcggcagcgaac gcaggcaagggcaacgagaagtcgcaccgcgacaagaagattcccgatgaccagcgcacg acgactccctacatgacaaagtacgagcgcgcccgcattctgggcacccgcgccctgcag atcagtatgaatgcaccggtgttggtggacttggaaggagagacggatcctcttcaaatc gcgatcaaggagctccgagagaagaagatccctctcattgtgcgccgctacatgcccgac ggatactacgaggattggacctgcgaggagcttctccagtga

DBGET integrated database retrieval system