Colletotrichum fioriniae: CFIO01_10748 Help Entry CFIO01_10748      CDS       T04796                                  Name (GenBank) LSM domain-containing protein   KO K12627   U6 snRNA-associated Sm-like protein LSm8 Organism cfj  Colletotrichum fioriniae Pathway cfj03018   RNA degradation cfj03040   Spliceosome Brite KEGG Orthology (KO) [BR:cfj00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     CFIO01_10748   09123 Folding, sorting and degradation    03018 RNA degradation     CFIO01_10748  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cfj03019]     CFIO01_10748    03041 Spliceosome [BR:cfj03041]     CFIO01_10748 Messenger RNA biogenesis [BR:cfj03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      CFIO01_10748   mRNA degradation factors    5'-3' decay     Lsm complex      CFIO01_10748 Spliceosome [BR:cfj03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     CFIO01_10748 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM Motif Other DBs NCBI-ProteinID:  EXF83254 UniProt:  A0A010RYC7 LinkDB All DBs AA seq 99 aa AA seqDB search MATLGGYLNKKVLIVTSDSRILVGTLEAADQSTNLVLSNAQERVIQTPESGEPSVEVPLG LYLVRGDNVCTIGLVDEALDDSINWTEVKGSAIGGTKHV NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggcaaccctcggaggctacctcaacaagaaagtcctcattgtgacgtcggactcacgg atcttggtgggcacattggaagctgcggaccagtccacgaacctcgttctcagcaatgcc caagagcgagtcatccaaacccccgagagcggcgaaccctctgtcgaagtgcctctcggc ctctatcttgttcgaggcgacaacgtctgcacaatcggcttggtagatgaggcactagac gatagcatcaactggaccgaagtcaagggttctgctattggaggaaccaagcacgtatga

DBGET integrated database retrieval system