Cornus florida (flowering dogwood): 132285605 Help Entry 132285605         CDS       T11641                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism cflo  Cornus florida (flowering dogwood) Pathway cflo03083   Polycomb repressive complex cflo04120   Ubiquitin mediated proteolysis cflo04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cflo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     132285605    04120 Ubiquitin mediated proteolysis     132285605   09126 Chromosome    03083 Polycomb repressive complex     132285605  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cflo04131]     132285605    04121 Ubiquitin system [BR:cflo04121]     132285605    03036 Chromosome and associated proteins [BR:cflo03036]     132285605 Membrane trafficking [BR:cflo04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     132285605 Ubiquitin system [BR:cflo04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      132285605    Cul7 complex      132285605 Chromosome and associated proteins [BR:cflo03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      132285605   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      132285605 SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Skp1 VipE DUF4769 Motif Other DBs NCBI-GeneID:  132285605 NCBI-ProteinID:  XP_059643776 LinkDB All DBs Position Unknown AA seq 155 aa AA seqDB search MSTSKPIVLRSSDGETFEVEEAVALESQTVKHIIEDDCADSIIPLPNVTGNILSKIIEYS KKHVETLKSEDNTSNDVIKSFDANFVEVDQVTLFDLILAATYLDNKSLLDLTCQKVADMI KGKTPEEIRNTFNIKNYFTHEEEEEVGRENVQAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcgacttcaaagccgattgtgttgagaagctcagatggtgagacctttgaggtggaa gaggccgtggctttggagtcacaaactgtcaagcatataatcgaagatgattgtgctgat tccatcattcctctaccgaatgtaaccggcaacatcttgtccaagatcatcgagtactcc aagaagcatgtcgagacccttaaatccgaagacaatacttccaacgatgttatcaaaagc ttcgatgccaacttcgtcgaagtcgaccaggtcaccctcttcgatctcatcttggctgca acttatttagacaacaagagtttgttagacctaacatgtcaaaaagtggcggacatgatc aaaggaaagactccagaggagattcgcaacacttttaacattaaaaattactttactcat gaggaagaagaggaggttggtagggagaatgtacaggcgtttgagtga

DBGET integrated database retrieval system