Chitinibacter fontanus: HZU75_12665 Help Entry HZU75_12665       CDS       T06720                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cfon  Chitinibacter fontanus Pathway cfon01100   Metabolic pathways cfon01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cfon00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HZU75_12665    00074 Mycolic acid biosynthesis     HZU75_12665   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HZU75_12665 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QLI82308 UniProt:  A0A7D5ZH59 LinkDB All DBs Position complement(2651615..2651875) Genome browser AA seq 86 aa AA seqDB search MDNTLINEIKLFVIETLNLEDITVDDIDTESPLFNEGLGLDSIDALELGVGLQKRYGIKL QSDSAENRQHFASIRSLAEFVSAQRQ NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtggacaacacgctgatcaacgaaattaaattatttgttattgagacgctgaatcttgaa gacattacggtcgacgatattgataccgaaagccccttatttaatgaaggcttaggcctt gattctatcgatgcgcttgaattaggcgttggcctacaaaaacgctacggcattaaattg caaagcgattcggccgaaaatcgccagcatttcgcatcaattcgcagtttggctgaattt gtcagcgcgcagcgccaataa

DBGET integrated database retrieval system