Citrobacter freundii complex sp. CFNIH3: C2U38_00585 Help Entry C2U38_00585       CDS       T06381                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cfq  Citrobacter freundii complex sp. CFNIH3 Pathway cfq01100   Metabolic pathways cfq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cfq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C2U38_00585    00074 Mycolic acid biosynthesis     C2U38_00585   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C2U38_00585 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding GshA Motif Other DBs NCBI-ProteinID:  AUV24265 LinkDB All DBs Position complement(129165..129416) Genome browser AA seq 83 aa AA seqDB search MTEQKAIYEEVSSLLVKLFEVDPQDIKPEARLYEDLELDSIDAVDMIVHLQKKTGKKIKP EEFKAVRTVQDVVDAVERLLIEA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaccgaacaaaaagccatttacgaagaagtctcctcactgctggtcaagctgtttgaa gttgacccgcaagatattaagcctgaggcgcgcctgtacgaagatctggaactcgacagc atcgacgcagtcgacatgatcgtgcatcttcaaaagaaaaccggtaagaaaatcaagccg gaagagttcaaagcagtacgcaccgtacaagatgtcgtcgatgcggttgaacgccttctc atagaagcgtaa

DBGET integrated database retrieval system