Citrobacter freundii complex sp. CFNIH3: C2U38_09490 Help Entry C2U38_09490       CDS       T06381                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cfq  Citrobacter freundii complex sp. CFNIH3 Pathway cfq01100   Metabolic pathways cfq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cfq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C2U38_09490    00074 Mycolic acid biosynthesis     C2U38_09490   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C2U38_09490 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AUV25845 LinkDB All DBs Position 1893750..1893986 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagtaaccaacaatgcttccttcgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcactaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system