Camelus ferus (Wild Bactrian camel): 102503556 Help Entry 102503556         CDS       T02979                                  Symbol CAV1 Name (RefSeq) caveolin-1 isoform X3   KO K06278   caveolin 1 Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04144   Endocytosis cfr04510   Focal adhesion cfr05020   Prion disease cfr05100   Bacterial invasion of epithelial cells cfr05205   Proteoglycans in cancer cfr05416   Viral myocarditis cfr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cfr00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102503556 (CAV1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102503556 (CAV1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102503556 (CAV1)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     102503556 (CAV1)   09164 Neurodegenerative disease    05020 Prion disease     102503556 (CAV1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102503556 (CAV1)    05416 Viral myocarditis     102503556 (CAV1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfr04131]     102503556 (CAV1) Membrane trafficking [BR:cfr04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     102503556 (CAV1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  102503556 NCBI-ProteinID:  XP_006177542 UniProt:  A0A8B6YCR6 LinkDB All DBs Position 7:complement(29925164..29957955) Genome browser AA seq 148 aa AA seqDB search MADEMNEEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFT TFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSI YVHTFCDPLFEAIGKIFSNIRINMQKEI NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggcagacgagatgaacgaggagaagcaagtgtacgacgcgcacaccaaggagattgac ctggtcaaccgcgaccccaagcatctcaacgacgacgtggtcaagattgattttgaagat gtgattgcggaaccagaagggacacacagtttcgatggcatctggaaggccagcttcacc accttcactgtgacgaagtactggttttaccgtttgctgtctgccctctttggcatccca atggcactcatctggggcatttacttcgccattctctctttcttgcacatctgggcggtt gtaccgtgcattaagagtttcctgattgagattcagtgcatcagccgtgtctattccatc tacgtccacaccttctgtgacccactctttgaggctatcggcaaaatattcagcaatatc cgcatcaacatgcagaaagaaatataa

DBGET integrated database retrieval system