Camelus ferus (Wild Bactrian camel): 102504527 Help Entry 102504527         CDS       T02979                                  Name (RefSeq) C-C motif chemokine 4   KO K12964   C-C motif chemokine 4 Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04060   Cytokine-cytokine receptor interaction cfr04061   Viral protein interaction with cytokine and cytokine receptor cfr04062   Chemokine signaling pathway cfr04064   NF-kappa B signaling pathway cfr04620   Toll-like receptor signaling pathway cfr04623   Cytosolic DNA-sensing pathway cfr05163   Human cytomegalovirus infection Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     102504527   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102504527    04061 Viral protein interaction with cytokine and cytokine receptor     102504527  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102504527    04623 Cytosolic DNA-sensing pathway     102504527    04062 Chemokine signaling pathway     102504527  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     102504527  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfr04052]     102504527 Cytokines and neuropeptides [BR:cfr04052]  Cytokines   Chemokines    102504527 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  102504527 NCBI-ProteinID:  XP_006173644 UniProt:  S9YPJ7 LinkDB All DBs Position 16:2051017..2053206 Genome browser AA seq 92 aa AA seqDB search MKLCVTVLSLLVLLAAFCSPALSAPMGSDPPTSCCFSYAQRKLPRNFVMDYYETSSLCSQ PAVVFQTKKGRQVCANPSESWVQEYVDDLELN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaagctctgcgtgactgtcctctccctcctcgtgctgctggctgccttctgctctccc gcactctcagcaccaatgggctcagaccctcccacttcctgctgcttctcttacgcccag cggaagcttcctcgcaacttcgtgatggattactatgagaccagcagcctctgctcccag ccagccgtggtattccaaaccaaaaagggcaggcaggtgtgtgccaaccccagcgagtcc tgggtccaggagtacgtggatgacctggaactgaactga

DBGET integrated database retrieval system