Camelus ferus (Wild Bactrian camel): 102504996 Help Entry 102504996         CDS       T02979                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1 isoform X2   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr01521   EGFR tyrosine kinase inhibitor resistance cfr01524   Platinum drug resistance cfr04014   Ras signaling pathway cfr04064   NF-kappa B signaling pathway cfr04115   p53 signaling pathway cfr04137   Mitophagy - animal cfr04140   Autophagy - animal cfr04151   PI3K-Akt signaling pathway cfr04210   Apoptosis cfr04215   Apoptosis - multiple species cfr04621   NOD-like receptor signaling pathway cfr04630   JAK-STAT signaling pathway cfr05012   Parkinson disease cfr05014   Amyotrophic lateral sclerosis cfr05022   Pathways of neurodegeneration - multiple diseases cfr05145   Toxoplasmosis cfr05162   Measles cfr05166   Human T-cell leukemia virus 1 infection cfr05168   Herpes simplex virus 1 infection cfr05170   Human immunodeficiency virus 1 infection cfr05200   Pathways in cancer cfr05202   Transcriptional misregulation in cancer cfr05212   Pancreatic cancer cfr05220   Chronic myeloid leukemia cfr05222   Small cell lung cancer cfr05225   Hepatocellular carcinoma cfr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102504996 (BCL2L1)    04630 JAK-STAT signaling pathway     102504996 (BCL2L1)    04064 NF-kappa B signaling pathway     102504996 (BCL2L1)    04151 PI3K-Akt signaling pathway     102504996 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102504996 (BCL2L1)    04137 Mitophagy - animal     102504996 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     102504996 (BCL2L1)    04215 Apoptosis - multiple species     102504996 (BCL2L1)    04115 p53 signaling pathway     102504996 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102504996 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102504996 (BCL2L1)    05202 Transcriptional misregulation in cancer     102504996 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     102504996 (BCL2L1)    05225 Hepatocellular carcinoma     102504996 (BCL2L1)    05220 Chronic myeloid leukemia     102504996 (BCL2L1)    05222 Small cell lung cancer     102504996 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102504996 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     102504996 (BCL2L1)    05162 Measles     102504996 (BCL2L1)    05168 Herpes simplex virus 1 infection     102504996 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102504996 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     102504996 (BCL2L1)    05014 Amyotrophic lateral sclerosis     102504996 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     102504996 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102504996 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102504996 (BCL2L1)    01524 Platinum drug resistance     102504996 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cfr01009]     102504996 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfr03036]     102504996 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:cfr02000]     102504996 (BCL2L1) Protein phosphatases and associated proteins [BR:cfr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      102504996 (BCL2L1) Chromosome and associated proteins [BR:cfr03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     102504996 (BCL2L1) Transporters [BR:cfr02000]  Other transporters   Pores ion channels [TC:1]    102504996 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  102504996 NCBI-ProteinID:  XP_006179292 UniProt:  S9YLW4 LinkDB All DBs Position 19:complement(35419266..35465532) Genome browser AA seq 233 aa AA seqDB search MSLSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMEIPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctctgagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaagccccagaaggg actgaatcagagatggaaatccccagtgccatcaatggcaacccatcctggcacctggca gacagccccgcggtgaatggagccactggccacagcagcagcttggatgcgcgggaggtg atccccatggcagcggtgaagcaagcgctgagggaggcgggtgatgagtttgaactgagg taccggcgagcattcagtgacctgacgtcccagctccacatcaccccagggacagcatat cagagctttgagcaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaacttggatggccacttacctgaatgatcacctagagcct tggatccaggagaacggcggctgggacacttttgtggaactctatgggaacaacgcagca gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg gctggtgtggttctgctgggctcgcttttcagtcggaaatga

DBGET integrated database retrieval system