Camelus ferus (Wild Bactrian camel): 102506036 Help Entry 102506036         CDS       T02979                                  Name (RefSeq) glutathione S-transferase Mu 1   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr00480   Glutathione metabolism cfr00980   Metabolism of xenobiotics by cytochrome P450 cfr00982   Drug metabolism - cytochrome P450 cfr00983   Drug metabolism - other enzymes cfr01100   Metabolic pathways cfr01524   Platinum drug resistance cfr05200   Pathways in cancer cfr05204   Chemical carcinogenesis - DNA adducts cfr05207   Chemical carcinogenesis - receptor activation cfr05208   Chemical carcinogenesis - reactive oxygen species cfr05225   Hepatocellular carcinoma cfr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cfr00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102506036   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102506036    00982 Drug metabolism - cytochrome P450     102506036    00983 Drug metabolism - other enzymes     102506036  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102506036    05204 Chemical carcinogenesis - DNA adducts     102506036    05207 Chemical carcinogenesis - receptor activation     102506036    05208 Chemical carcinogenesis - reactive oxygen species     102506036   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102506036   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102506036   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102506036  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:cfr02000]     102506036 Enzymes [BR:cfr01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102506036 Transporters [BR:cfr02000]  Other transporters   Pores ion channels [TC:1]    102506036 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_N GST_C GST_C_3 GST_N_2 GST_N_3 GST_C_6 GST_C_2 Motif Other DBs NCBI-GeneID:  102506036 NCBI-ProteinID:  XP_006180023 UniProt:  A0A8B6YB80 LinkDB All DBs Position 9:77881635..77890449 Genome browser AA seq 218 aa AA seqDB search MPMILGYWDIRGLAHAIRLLLEYTGSDYEEKIYSMGDAPDYDRSQWLSEKFKLGLDFPNL PYLIDGAHRLTQSNAILRYIARKHNLCGETEEEKIRVDVLENQAMDTRLDFSRVCYNPDF EKLKPGFLKEIPEKMKLFSEFLGKRTWFAGDKLNYVDFLAYDVLDVYRIFEPKCLDEFPN LKDFMSRFEGLKKISAYMKSSRFLRSPLFLKMAMWGNK NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgcctatgatcctgggttactgggacatccgcgggctggctcacgccatccgcctgctc ttggagtacacaggctcagactatgaggagaagatttactcgatgggggacgctcctgac tatgatagaagccagtggctgagtgaaaaattcaagctgggcctggacttccccaatctg ccctacctaattgatggggctcacaggctcacccagagcaacgccatccttcgctacatt gctcgcaagcacaacctgtgtggggagacagaggaggagaagattcgagtggacgttttg gagaaccaggctatggacacgcgcttggatttctccagagtctgctacaaccctgacttt gagaagcttaagccaggtttcttgaaagagatccctgaaaagatgaagctcttctcagag tttctggggaagaggacttggtttgcaggagacaagctcaactatgtggatttcttggct tatgatgtccttgacgtgtaccgcatatttgagcccaagtgcctggatgaattcccaaac ctgaaagacttcatgagccgctttgagggcctgaagaagatttctgcctacatgaagtcc agccgcttcctccgaagccctctgtttctaaagatggccatgtggggcaacaagtag

DBGET integrated database retrieval system