Camelus ferus (Wild Bactrian camel): 102506049 Help Entry 102506049         CDS       T02979                                  Symbol B2M Name (RefSeq) beta-2-microglobulin   KO K08055   beta-2-microglobulin Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04612   Antigen processing and presentation cfr05163   Human cytomegalovirus infection cfr05166   Human T-cell leukemia virus 1 infection cfr05168   Herpes simplex virus 1 infection cfr05169   Epstein-Barr virus infection cfr05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:cfr00001]  09150 Organismal Systems   09151 Immune system    04612 Antigen processing and presentation     102506049 (B2M)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102506049 (B2M)    05170 Human immunodeficiency virus 1 infection     102506049 (B2M)    05168 Herpes simplex virus 1 infection     102506049 (B2M)    05163 Human cytomegalovirus infection     102506049 (B2M)    05169 Epstein-Barr virus infection     102506049 (B2M)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfr04147]     102506049 (B2M) Exosome [BR:cfr04147]  Exosomal proteins   Exosomal proteins of breast milk    102506049 (B2M) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  C1-set Ig_3 I-set Ig_2 C2-set_3 Cna_B Motif Other DBs NCBI-GeneID:  102506049 NCBI-ProteinID:  XP_032337211 UniProt:  S9WVH2 LinkDB All DBs Position 6:complement(19824255..19829852) Genome browser AA seq 118 aa AA seqDB search MARVVPLVLLGLLSLSSLDAIQRTPKIQVYSRHPAENEKPNFLNCYVSGFHPPQIEIDLL KNGQKMKAEQSDLSFSKDWSFYLLVHTNFTPNARDEYSCRVNHVTLQEPKIVKWDRDQ NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggctcgcgtggtgcccttggtcctgctcggactgctctcgctgtccagcctggacgcc atccagcgtactccgaagattcaggtttactcccgtcacccagcggagaatgagaagcca aatttcttgaactgctatgtgtctgggttccacccaccacagattgaaattgatttgctg aagaacgggcagaagatgaaagcggagcagtctgacctgtctttcagcaaggactggtct ttctatctcctggtccacactaacttcacgcccaacgcaagagatgagtacagctgccgc gtgaatcacgtgactctccaggaacccaagatagttaagtgggatcgagaccagtaa

DBGET integrated database retrieval system