Camelus ferus (Wild Bactrian camel): 102506474 Help Entry 102506474         CDS       T02979                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04613   Neutrophil extracellular trap formation cfr05034   Alcoholism cfr05202   Transcriptional misregulation in cancer cfr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cfr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102506474  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102506474   09163 Immune disease    05322 Systemic lupus erythematosus     102506474   09165 Substance dependence    05034 Alcoholism     102506474  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfr03036]     102506474   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfr04147]     102506474 Chromosome and associated proteins [BR:cfr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102506474 Exosome [BR:cfr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102506474 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  102506474 NCBI-ProteinID:  XP_014412655 UniProt:  S9WX72 LinkDB All DBs Position 20:complement(17914059..17914854) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtaccaagcagacggcccgcaagtccaccggcggtaaagcgccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggcgtgaagaagccgcac cgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtccacggag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctac ctggtggggctcttcgaggacaccaatctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacattcagctcgcgcgccgcatccgcggggagagggcgtaa

DBGET integrated database retrieval system