Camelus ferus (Wild Bactrian camel): 102506663 Help Entry 102506663         CDS       T02979                                  Symbol PPBP Name (RefSeq) platelet basic protein   KO K10029   platelet basic protein Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04060   Cytokine-cytokine receptor interaction cfr04061   Viral protein interaction with cytokine and cytokine receptor cfr04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102506663 (PPBP)    04061 Viral protein interaction with cytokine and cytokine receptor     102506663 (PPBP)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     102506663 (PPBP)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfr04052]     102506663 (PPBP) Cytokines and neuropeptides [BR:cfr04052]  Cytokines   Chemokines    102506663 (PPBP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  102506663 NCBI-ProteinID:  XP_006188760 UniProt:  S9Y2J3 LinkDB All DBs Position 2:complement(50799842..50801384) Genome browser AA seq 119 aa AA seqDB search MSRRPSAASYCASASPLPALQVLLLLSLLLTTLVPSTIGETKRGERLLYVELRCLCVKTT SGIHPSNIQSLEVTRAGPHCTKVEVIALLKNGKKICLDPEAPVIKKIVQKMLEDRGSAA NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgagccgcagacccagcgccgcctcctactgtgccagcgccagcccacttcctgccctc caggtgttgctgctactgtcactgctcctgaccacgctggttccctccaccatcggagaa actaaacgtggggaaagattgctgtatgtggaacttcgctgcctgtgtgtgaagaccacc tctggcattcatcccagtaacatccaaagtctggaggtgaccagggcaggaccccactgc accaaagttgaagtgatagccctgctgaagaatgggaagaaaatctgcctggacccagaa gctcctgtaatcaagaaaatagtccagaaaatgctggaagatcgtgggtcagctgcttaa

DBGET integrated database retrieval system