Camelus ferus (Wild Bactrian camel): 102506820 Help Entry 102506820         CDS       T02979                                  Symbol MYCBP Name (RefSeq) C-Myc-binding protein isoform X1   KO K25550   c-Myc-binding protein Organism cfr  Camelus ferus (Wild Bactrian camel) Brite KEGG Orthology (KO) [BR:cfr00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cfr03037]     102506820 (MYCBP) Cilium and associated proteins [BR:cfr03037]  Motile cilia and associated proteins   Sperm associated proteins    102506820 (MYCBP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TSC22 ZapB YabA Motif Other DBs NCBI-GeneID:  102506820 NCBI-ProteinID:  XP_032349793 UniProt:  A0A8B8U699 LinkDB All DBs Position 13:complement(27644000..27651189) Genome browser AA seq 103 aa AA seqDB search MAYYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENP EIELLRLELAEMKEKYEAIVEENKKLKTKLAQYEPPQEEKRAE NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggcctattacaaagccgccgactcgaagcgcgagcagttccggaggtacttggagaag tcgggggtgctggacacgctgaccaaggtattggtagccttatatgaagaaccagagaaa cctaatagtgctttggattttttaaagcatcacttaggagctgctaccccagaaaatcca gaaatagagctgcttcgcctagaattggcagaaatgaaagagaaatatgaagctattgta gaagaaaataaaaaactaaaaacaaagcttgctcagtatgaaccacctcaggaggagaag cgtgctgaatag

DBGET integrated database retrieval system