Camelus ferus (Wild Bactrian camel): 102507993 Help Entry 102507993         CDS       T02979                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04014   Ras signaling pathway cfr04015   Rap1 signaling pathway cfr04022   cGMP-PKG signaling pathway cfr04024   cAMP signaling pathway cfr04062   Chemokine signaling pathway cfr04071   Sphingolipid signaling pathway cfr04072   Phospholipase D signaling pathway cfr04144   Endocytosis cfr04150   mTOR signaling pathway cfr04270   Vascular smooth muscle contraction cfr04310   Wnt signaling pathway cfr04350   TGF-beta signaling pathway cfr04360   Axon guidance cfr04510   Focal adhesion cfr04520   Adherens junction cfr04530   Tight junction cfr04611   Platelet activation cfr04621   NOD-like receptor signaling pathway cfr04625   C-type lectin receptor signaling pathway cfr04660   T cell receptor signaling pathway cfr04670   Leukocyte transendothelial migration cfr04722   Neurotrophin signaling pathway cfr04810   Regulation of actin cytoskeleton cfr04921   Oxytocin signaling pathway cfr04928   Parathyroid hormone synthesis, secretion and action cfr04972   Pancreatic secretion cfr05100   Bacterial invasion of epithelial cells cfr05132   Salmonella infection cfr05133   Pertussis cfr05135   Yersinia infection cfr05152   Tuberculosis cfr05163   Human cytomegalovirus infection cfr05200   Pathways in cancer cfr05203   Viral carcinogenesis cfr05205   Proteoglycans in cancer cfr05206   MicroRNAs in cancer cfr05210   Colorectal cancer cfr05417   Lipid and atherosclerosis cfr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102507993 (RHOA)    04015 Rap1 signaling pathway     102507993 (RHOA)    04310 Wnt signaling pathway     102507993 (RHOA)    04350 TGF-beta signaling pathway     102507993 (RHOA)    04072 Phospholipase D signaling pathway     102507993 (RHOA)    04071 Sphingolipid signaling pathway     102507993 (RHOA)    04024 cAMP signaling pathway     102507993 (RHOA)    04022 cGMP-PKG signaling pathway     102507993 (RHOA)    04150 mTOR signaling pathway     102507993 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102507993 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102507993 (RHOA)    04520 Adherens junction     102507993 (RHOA)    04530 Tight junction     102507993 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102507993 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102507993 (RHOA)    04621 NOD-like receptor signaling pathway     102507993 (RHOA)    04625 C-type lectin receptor signaling pathway     102507993 (RHOA)    04660 T cell receptor signaling pathway     102507993 (RHOA)    04670 Leukocyte transendothelial migration     102507993 (RHOA)    04062 Chemokine signaling pathway     102507993 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     102507993 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     102507993 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     102507993 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     102507993 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     102507993 (RHOA)   09158 Development and regeneration    04360 Axon guidance     102507993 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102507993 (RHOA)    05206 MicroRNAs in cancer     102507993 (RHOA)    05205 Proteoglycans in cancer     102507993 (RHOA)    05203 Viral carcinogenesis     102507993 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     102507993 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     102507993 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     102507993 (RHOA)    05135 Yersinia infection     102507993 (RHOA)    05133 Pertussis     102507993 (RHOA)    05152 Tuberculosis     102507993 (RHOA)    05100 Bacterial invasion of epithelial cells     102507993 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102507993 (RHOA)    05418 Fluid shear stress and atherosclerosis     102507993 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfr04131]     102507993 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfr04147]     102507993 (RHOA)    04031 GTP-binding proteins [BR:cfr04031]     102507993 (RHOA) Membrane trafficking [BR:cfr04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     102507993 (RHOA) Exosome [BR:cfr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102507993 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    102507993 (RHOA)   Exosomal proteins of colorectal cancer cells    102507993 (RHOA)   Exosomal proteins of bladder cancer cells    102507993 (RHOA) GTP-binding proteins [BR:cfr04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     102507993 (RHOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  102507993 NCBI-ProteinID:  XP_014419246 UniProt:  A0A8B8RBL8 LinkDB All DBs Position 17:25715885..25760916 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgctatccggaagaaattggtgatagttggtgatggagcctgtggcaagacttgc ttgctcattgtctttagcaaggaccagttcccggaggtgtatgtacctacggtatttgag aactatgtggcagatattgaagtggatggaaagcaggtagagttggctttgtgggacaca gctgggcaggaagattatgatcgcttgaggcccctctcctacccggataccgatgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact ccggaagtcaagcatttctgtccgaacgtgcccatcatcctggttgggaacaagaaggat cttcgaaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccagtaaag ccagaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgctca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacaagagctgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system