Camelus ferus (Wild Bactrian camel): 102508854 Help Entry 102508854         CDS       T02979                                  Name (RefSeq) histone H2B type 1-A   KO K11252   histone H2B Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04613   Neutrophil extracellular trap formation cfr05034   Alcoholism cfr05203   Viral carcinogenesis cfr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cfr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102508854  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102508854   09163 Immune disease    05322 Systemic lupus erythematosus     102508854   09165 Substance dependence    05034 Alcoholism     102508854  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfr03036]     102508854   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfr04147]     102508854 Chromosome and associated proteins [BR:cfr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102508854 Exosome [BR:cfr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102508854 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like ARM_TT21 TFIID_20kDa Motif Other DBs NCBI-GeneID:  102508854 NCBI-ProteinID:  XP_006182260 UniProt:  S9YFW5 LinkDB All DBs Position 20:complement(17718702..17719085) Genome browser AA seq 127 aa AA seqDB search MPELTSKGSTISKKGFKNAVTKTQKKEGKKRKRCRKESYSIYIYKVLKQVHPDTGISSKA MSIMNSFVSDIFERIAGEASRLAHYNKRLTITSREIQTAVRLLLPGELAKHAVSEGTKAV TKYTSSK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgccagagctgacttcaaagggctctaccatttctaagaaaggcttcaaaaatgctgta actaaaacccagaagaaggaagggaaaaagcgcaagagatgtcgcaaagagagctattca atttacatctacaaggtgctgaagcaagttcaccccgataccggtatctcttcaaaggcc atgagcatcatgaattcttttgtcagtgatattttcgagcgcatcgcgggcgaggcatcg cgcctggcgcattacaacaagcgcttgaccatcacgtcccgggagatccagacggccgtg cgcctgctgctgcccggggagctagccaagcacgccgtgtctgagggcaccaaggccgtc accaagtacaccagctccaagtaa

DBGET integrated database retrieval system