Camelus ferus (Wild Bactrian camel): 102509091 Help Entry 102509091         CDS       T02979                                  Name (RefSeq) histone H2B type 1-A   KO K11252   histone H2B Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04613   Neutrophil extracellular trap formation cfr05034   Alcoholism cfr05203   Viral carcinogenesis cfr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cfr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102509091  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102509091   09163 Immune disease    05322 Systemic lupus erythematosus     102509091   09165 Substance dependence    05034 Alcoholism     102509091  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfr03036]     102509091   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfr04147]     102509091 Chromosome and associated proteins [BR:cfr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102509091 Exosome [BR:cfr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102509091 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  102509091 NCBI-ProteinID:  XP_006182261 UniProt:  S9Y6U1 LinkDB All DBs Position 20:17713792..17714187 Genome browser AA seq 128 aa AA seqDB search MMPELPSKSATVSKKGFKKAVTKTQKKEGKRRKRCRKESYSIYIYKVLKQVHPDTGISSK AMSIMNSFVTDIFERIAGEASRLTHYSKHSTITSREIQTAVRLLLPGELAKHAVSEGTKA VTKYTSSK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgatgccagagctgccttcaaagagcgctactgtttctaagaagggctttaagaaagct gtaacgaaaactcagaagaaagaaggaaaaaggcgtaagagatgtcgcaaagagagctat tcaatttacatctacaaggtactgaagcaagttcatcctgatactggcatctcttcaaag gccatgagcatcatgaattccttcgtcaccgatatctttgagcgtattgctggggaggcg tcgcgcttaacacattatagcaaacactcgaccatcacatcccgggaaatccagacagct gtgcgcttgctactgcctggggagctggccaagcacgccgtgtctgaaggtactaaggct gttaccaagtacaccagctccaagtaa

DBGET integrated database retrieval system