Camelus ferus (Wild Bactrian camel): 102509266 Help Entry 102509266         CDS       T02979                                  Symbol RAB1A Name (RefSeq) ras-related protein Rab-1A   KO K07874   Ras-related protein Rab-1A Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04140   Autophagy - animal cfr05014   Amyotrophic lateral sclerosis cfr05022   Pathways of neurodegeneration - multiple diseases cfr05134   Legionellosis Brite KEGG Orthology (KO) [BR:cfr00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102509266 (RAB1A)  09160 Human Diseases   09171 Infectious disease: bacterial    05134 Legionellosis     102509266 (RAB1A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102509266 (RAB1A)    05022 Pathways of neurodegeneration - multiple diseases     102509266 (RAB1A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfr04131]     102509266 (RAB1A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfr04147]     102509266 (RAB1A)    04031 GTP-binding proteins [BR:cfr04031]     102509266 (RAB1A) Membrane trafficking [BR:cfr04131]  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Rab GTPases     102509266 (RAB1A)  Autophagy   Other autophagy associated proteins     102509266 (RAB1A) Exosome [BR:cfr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102509266 (RAB1A)   Exosomal proteins of other body fluids (saliva and urine)    102509266 (RAB1A)   Exosomal proteins of colorectal cancer cells    102509266 (RAB1A) GTP-binding proteins [BR:cfr04031]  Small (monomeric) G-proteins   Rab Family    Rab1/35 [OT]     102509266 (RAB1A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 Gtr1_RagA SRPRB FeoB_N AAA ABC_tran AAA_7 PduV-EutP AAA_16 LANC_like AAA_29 Septin AAA_22 AAA_5 CRAL_TRIO_2 Motif Other DBs NCBI-GeneID:  102509266 NCBI-ProteinID:  XP_032353584 UniProt:  A0A8B8UG82 LinkDB All DBs Position 15:complement(47116425..47142679) Genome browser AA seq 205 aa AA seqDB search MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTI KLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKL LVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGA TAGGAEKSNVKIQSTPVKQSGGGCC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgtccagcatgaatcccgaatatgattatttattcaagttacttctgattggcgactct ggggttggaaagtcttgcctccttcttagatttgcggatgatacatacacagaaagctac atcagcacaattggtgtggatttcaagataagaactatagaattagatgggaaaacaatc aagcttcaaatatgggacacagcaggccaagaaagatttcgaacaatcacctccagttac tacagaggagcccatggcatcatagttgtgtatgatgtgacagatcaggagtccttcaat aatgttaaacagtggctacaggaaatagatcgttatgccagtgaaaacgtcaacaagttg ttggtagggaacaaatgtgatctgaccacaaagaaagtagtagactacacaacagcaaag gaatttgctgattcccttggaattccatttttggaaaccagtgctaagaatgcaacaaat gtagaacagtctttcatgacgatggcagctgagattaaaaagcgaatgggtcctggagca acagctggtggtgcagagaagtccaatgttaaaattcagagcactccggtcaagcagtca ggtggaggttgctgctaa

DBGET integrated database retrieval system