Camelus ferus (Wild Bactrian camel): 102509562 Help Entry 102509562         CDS       T02979                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr01521   EGFR tyrosine kinase inhibitor resistance cfr01522   Endocrine resistance cfr04010   MAPK signaling pathway cfr04012   ErbB signaling pathway cfr04014   Ras signaling pathway cfr04015   Rap1 signaling pathway cfr04062   Chemokine signaling pathway cfr04068   FoxO signaling pathway cfr04071   Sphingolipid signaling pathway cfr04072   Phospholipase D signaling pathway cfr04137   Mitophagy - animal cfr04140   Autophagy - animal cfr04150   mTOR signaling pathway cfr04151   PI3K-Akt signaling pathway cfr04210   Apoptosis cfr04211   Longevity regulating pathway cfr04213   Longevity regulating pathway - multiple species cfr04218   Cellular senescence cfr04360   Axon guidance cfr04370   VEGF signaling pathway cfr04371   Apelin signaling pathway cfr04540   Gap junction cfr04550   Signaling pathways regulating pluripotency of stem cells cfr04625   C-type lectin receptor signaling pathway cfr04650   Natural killer cell mediated cytotoxicity cfr04660   T cell receptor signaling pathway cfr04662   B cell receptor signaling pathway cfr04664   Fc epsilon RI signaling pathway cfr04714   Thermogenesis cfr04720   Long-term potentiation cfr04722   Neurotrophin signaling pathway cfr04725   Cholinergic synapse cfr04726   Serotonergic synapse cfr04730   Long-term depression cfr04810   Regulation of actin cytoskeleton cfr04910   Insulin signaling pathway cfr04912   GnRH signaling pathway cfr04915   Estrogen signaling pathway cfr04916   Melanogenesis cfr04917   Prolactin signaling pathway cfr04919   Thyroid hormone signaling pathway cfr04921   Oxytocin signaling pathway cfr04926   Relaxin signaling pathway cfr04929   GnRH secretion cfr04933   AGE-RAGE signaling pathway in diabetic complications cfr04935   Growth hormone synthesis, secretion and action cfr05010   Alzheimer disease cfr05022   Pathways of neurodegeneration - multiple diseases cfr05034   Alcoholism cfr05160   Hepatitis C cfr05161   Hepatitis B cfr05163   Human cytomegalovirus infection cfr05165   Human papillomavirus infection cfr05166   Human T-cell leukemia virus 1 infection cfr05167   Kaposi sarcoma-associated herpesvirus infection cfr05170   Human immunodeficiency virus 1 infection cfr05200   Pathways in cancer cfr05203   Viral carcinogenesis cfr05205   Proteoglycans in cancer cfr05206   MicroRNAs in cancer cfr05207   Chemical carcinogenesis - receptor activation cfr05208   Chemical carcinogenesis - reactive oxygen species cfr05210   Colorectal cancer cfr05211   Renal cell carcinoma cfr05213   Endometrial cancer cfr05214   Glioma cfr05215   Prostate cancer cfr05216   Thyroid cancer cfr05218   Melanoma cfr05219   Bladder cancer cfr05220   Chronic myeloid leukemia cfr05221   Acute myeloid leukemia cfr05223   Non-small cell lung cancer cfr05224   Breast cancer cfr05225   Hepatocellular carcinoma cfr05226   Gastric cancer cfr05230   Central carbon metabolism in cancer cfr05231   Choline metabolism in cancer cfr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer cfr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102509562 (NRAS)    04015 Rap1 signaling pathway     102509562 (NRAS)    04068 FoxO signaling pathway     102509562 (NRAS)    04072 Phospholipase D signaling pathway     102509562 (NRAS)    04071 Sphingolipid signaling pathway     102509562 (NRAS)    04151 PI3K-Akt signaling pathway     102509562 (NRAS)    04150 mTOR signaling pathway     102509562 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102509562 (NRAS)    04137 Mitophagy - animal     102509562 (NRAS)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     102509562 (NRAS)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     102509562 (NRAS)    04660 T cell receptor signaling pathway     102509562 (NRAS)    04662 B cell receptor signaling pathway     102509562 (NRAS)    04664 Fc epsilon RI signaling pathway     102509562 (NRAS)    04062 Chemokine signaling pathway     102509562 (NRAS)   09152 Endocrine system    04929 GnRH secretion     102509562 (NRAS)    04915 Estrogen signaling pathway     102509562 (NRAS)    04917 Prolactin signaling pathway     102509562 (NRAS)    04921 Oxytocin signaling pathway     102509562 (NRAS)    04926 Relaxin signaling pathway     102509562 (NRAS)    04935 Growth hormone synthesis, secretion and action     102509562 (NRAS)    04919 Thyroid hormone signaling pathway     102509562 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     102509562 (NRAS)    04726 Serotonergic synapse     102509562 (NRAS)    04720 Long-term potentiation     102509562 (NRAS)    04730 Long-term depression     102509562 (NRAS)    04722 Neurotrophin signaling pathway     102509562 (NRAS)   09158 Development and regeneration    04360 Axon guidance     102509562 (NRAS)   09149 Aging    04211 Longevity regulating pathway     102509562 (NRAS)    04213 Longevity regulating pathway - multiple species     102509562 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     102509562 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102509562 (NRAS)    05206 MicroRNAs in cancer     102509562 (NRAS)    05205 Proteoglycans in cancer     102509562 (NRAS)    05207 Chemical carcinogenesis - receptor activation     102509562 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     102509562 (NRAS)    05203 Viral carcinogenesis     102509562 (NRAS)    05230 Central carbon metabolism in cancer     102509562 (NRAS)    05231 Choline metabolism in cancer     102509562 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102509562 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     102509562 (NRAS)    05225 Hepatocellular carcinoma     102509562 (NRAS)    05226 Gastric cancer     102509562 (NRAS)    05214 Glioma     102509562 (NRAS)    05216 Thyroid cancer     102509562 (NRAS)    05221 Acute myeloid leukemia     102509562 (NRAS)    05220 Chronic myeloid leukemia     102509562 (NRAS)    05218 Melanoma     102509562 (NRAS)    05211 Renal cell carcinoma     102509562 (NRAS)    05219 Bladder cancer     102509562 (NRAS)    05215 Prostate cancer     102509562 (NRAS)    05213 Endometrial cancer     102509562 (NRAS)    05224 Breast cancer     102509562 (NRAS)    05223 Non-small cell lung cancer     102509562 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102509562 (NRAS)    05170 Human immunodeficiency virus 1 infection     102509562 (NRAS)    05161 Hepatitis B     102509562 (NRAS)    05160 Hepatitis C     102509562 (NRAS)    05163 Human cytomegalovirus infection     102509562 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     102509562 (NRAS)    05165 Human papillomavirus infection     102509562 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     102509562 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     102509562 (NRAS)   09165 Substance dependence    05034 Alcoholism     102509562 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102509562 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102509562 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102509562 (NRAS)    01522 Endocrine resistance     102509562 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfr04131]     102509562 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfr04147]     102509562 (NRAS)    04031 GTP-binding proteins [BR:cfr04031]     102509562 (NRAS) Membrane trafficking [BR:cfr04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     102509562 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     102509562 (NRAS) Exosome [BR:cfr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102509562 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    102509562 (NRAS)   Exosomal proteins of breast cancer cells    102509562 (NRAS)   Exosomal proteins of colorectal cancer cells    102509562 (NRAS) GTP-binding proteins [BR:cfr04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102509562 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  102509562 NCBI-ProteinID:  XP_006193222 UniProt:  A0A8B6YRJ0 LinkDB All DBs Position 9:61749870..61759838 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaagtggttatagatggtgaaacctgtctgttggacatactggatacagctgga caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt aaacgagtaaaagactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattcca ttcatcgaaacctcagccaagaccagacagggtgttgaagatgccttttatacactggta agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatggaactcaaggt tgtatggggttgccgtgtgtggtgatgtaa

DBGET integrated database retrieval system