KEGG   Camelus ferus (Wild Bactrian camel): 102509562
Entry
102509562         CDS       T02979                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr04010  MAPK signaling pathway
cfr04012  ErbB signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04062  Chemokine signaling pathway
cfr04068  FoxO signaling pathway
cfr04071  Sphingolipid signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04137  Mitophagy - animal
cfr04140  Autophagy - animal
cfr04150  mTOR signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04210  Apoptosis
cfr04211  Longevity regulating pathway
cfr04213  Longevity regulating pathway - multiple species
cfr04218  Cellular senescence
cfr04360  Axon guidance
cfr04370  VEGF signaling pathway
cfr04371  Apelin signaling pathway
cfr04540  Gap junction
cfr04550  Signaling pathways regulating pluripotency of stem cells
cfr04625  C-type lectin receptor signaling pathway
cfr04650  Natural killer cell mediated cytotoxicity
cfr04660  T cell receptor signaling pathway
cfr04662  B cell receptor signaling pathway
cfr04664  Fc epsilon RI signaling pathway
cfr04714  Thermogenesis
cfr04720  Long-term potentiation
cfr04722  Neurotrophin signaling pathway
cfr04725  Cholinergic synapse
cfr04726  Serotonergic synapse
cfr04730  Long-term depression
cfr04810  Regulation of actin cytoskeleton
cfr04910  Insulin signaling pathway
cfr04912  GnRH signaling pathway
cfr04915  Estrogen signaling pathway
cfr04916  Melanogenesis
cfr04917  Prolactin signaling pathway
cfr04919  Thyroid hormone signaling pathway
cfr04921  Oxytocin signaling pathway
cfr04926  Relaxin signaling pathway
cfr04929  GnRH secretion
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr04935  Growth hormone synthesis, secretion and action
cfr05010  Alzheimer disease
cfr05022  Pathways of neurodegeneration - multiple diseases
cfr05034  Alcoholism
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05163  Human cytomegalovirus infection
cfr05165  Human papillomavirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05200  Pathways in cancer
cfr05203  Viral carcinogenesis
cfr05205  Proteoglycans in cancer
cfr05206  MicroRNAs in cancer
cfr05207  Chemical carcinogenesis - receptor activation
cfr05208  Chemical carcinogenesis - reactive oxygen species
cfr05210  Colorectal cancer
cfr05211  Renal cell carcinoma
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05216  Thyroid cancer
cfr05218  Melanoma
cfr05219  Bladder cancer
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
cfr05230  Central carbon metabolism in cancer
cfr05231  Choline metabolism in cancer
cfr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cfr05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102509562 (NRAS)
   04012 ErbB signaling pathway
    102509562 (NRAS)
   04014 Ras signaling pathway
    102509562 (NRAS)
   04015 Rap1 signaling pathway
    102509562 (NRAS)
   04370 VEGF signaling pathway
    102509562 (NRAS)
   04371 Apelin signaling pathway
    102509562 (NRAS)
   04068 FoxO signaling pathway
    102509562 (NRAS)
   04072 Phospholipase D signaling pathway
    102509562 (NRAS)
   04071 Sphingolipid signaling pathway
    102509562 (NRAS)
   04151 PI3K-Akt signaling pathway
    102509562 (NRAS)
   04150 mTOR signaling pathway
    102509562 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102509562 (NRAS)
   04137 Mitophagy - animal
    102509562 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    102509562 (NRAS)
   04218 Cellular senescence
    102509562 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102509562 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    102509562 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102509562 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102509562 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    102509562 (NRAS)
   04660 T cell receptor signaling pathway
    102509562 (NRAS)
   04662 B cell receptor signaling pathway
    102509562 (NRAS)
   04664 Fc epsilon RI signaling pathway
    102509562 (NRAS)
   04062 Chemokine signaling pathway
    102509562 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102509562 (NRAS)
   04929 GnRH secretion
    102509562 (NRAS)
   04912 GnRH signaling pathway
    102509562 (NRAS)
   04915 Estrogen signaling pathway
    102509562 (NRAS)
   04917 Prolactin signaling pathway
    102509562 (NRAS)
   04921 Oxytocin signaling pathway
    102509562 (NRAS)
   04926 Relaxin signaling pathway
    102509562 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    102509562 (NRAS)
   04919 Thyroid hormone signaling pathway
    102509562 (NRAS)
   04916 Melanogenesis
    102509562 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    102509562 (NRAS)
   04726 Serotonergic synapse
    102509562 (NRAS)
   04720 Long-term potentiation
    102509562 (NRAS)
   04730 Long-term depression
    102509562 (NRAS)
   04722 Neurotrophin signaling pathway
    102509562 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    102509562 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    102509562 (NRAS)
   04213 Longevity regulating pathway - multiple species
    102509562 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    102509562 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102509562 (NRAS)
   05206 MicroRNAs in cancer
    102509562 (NRAS)
   05205 Proteoglycans in cancer
    102509562 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    102509562 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    102509562 (NRAS)
   05203 Viral carcinogenesis
    102509562 (NRAS)
   05230 Central carbon metabolism in cancer
    102509562 (NRAS)
   05231 Choline metabolism in cancer
    102509562 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102509562 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102509562 (NRAS)
   05225 Hepatocellular carcinoma
    102509562 (NRAS)
   05226 Gastric cancer
    102509562 (NRAS)
   05214 Glioma
    102509562 (NRAS)
   05216 Thyroid cancer
    102509562 (NRAS)
   05221 Acute myeloid leukemia
    102509562 (NRAS)
   05220 Chronic myeloid leukemia
    102509562 (NRAS)
   05218 Melanoma
    102509562 (NRAS)
   05211 Renal cell carcinoma
    102509562 (NRAS)
   05219 Bladder cancer
    102509562 (NRAS)
   05215 Prostate cancer
    102509562 (NRAS)
   05213 Endometrial cancer
    102509562 (NRAS)
   05224 Breast cancer
    102509562 (NRAS)
   05223 Non-small cell lung cancer
    102509562 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102509562 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    102509562 (NRAS)
   05161 Hepatitis B
    102509562 (NRAS)
   05160 Hepatitis C
    102509562 (NRAS)
   05163 Human cytomegalovirus infection
    102509562 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102509562 (NRAS)
   05165 Human papillomavirus infection
    102509562 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102509562 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    102509562 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    102509562 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102509562 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102509562 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102509562 (NRAS)
   01522 Endocrine resistance
    102509562 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfr04131]
    102509562 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfr04147]
    102509562 (NRAS)
   04031 GTP-binding proteins [BR:cfr04031]
    102509562 (NRAS)
Membrane trafficking [BR:cfr04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    102509562 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    102509562 (NRAS)
Exosome [BR:cfr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102509562 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   102509562 (NRAS)
  Exosomal proteins of breast cancer cells
   102509562 (NRAS)
  Exosomal proteins of colorectal cancer cells
   102509562 (NRAS)
GTP-binding proteins [BR:cfr04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    102509562 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA
Other DBs
NCBI-GeneID: 102509562
NCBI-ProteinID: XP_006193222
UniProt: A0A8B6YRJ0
LinkDB
Position
9:61749870..61759838
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
cgaaaacaagtggttatagatggtgaaacctgtctgttggacatactggatacagctgga
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt
gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt
aaacgagtaaaagactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattcca
ttcatcgaaacctcagccaagaccagacagggtgttgaagatgccttttatacactggta
agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatggaactcaaggt
tgtatggggttgccgtgtgtggtgatgtaa

DBGET integrated database retrieval system