Camelus ferus (Wild Bactrian camel): 102510298 Help Entry 102510298         CDS       T02979                                  Symbol RAB5C Name (RefSeq) ras-related protein Rab-5C   KO K07889   Ras-related protein Rab-5C Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04014   Ras signaling pathway cfr04137   Mitophagy - animal cfr04144   Endocytosis cfr04145   Phagosome cfr04148   Efferocytosis cfr04962   Vasopressin-regulated water reabsorption cfr05132   Salmonella infection cfr05146   Amoebiasis cfr05152   Tuberculosis Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102510298 (RAB5C)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102510298 (RAB5C)    04145 Phagosome     102510298 (RAB5C)    04137 Mitophagy - animal     102510298 (RAB5C)    04148 Efferocytosis     102510298 (RAB5C)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     102510298 (RAB5C)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102510298 (RAB5C)    05152 Tuberculosis     102510298 (RAB5C)   09174 Infectious disease: parasitic    05146 Amoebiasis     102510298 (RAB5C)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfr04131]     102510298 (RAB5C)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfr04147]     102510298 (RAB5C)    04031 GTP-binding proteins [BR:cfr04031]     102510298 (RAB5C) Membrane trafficking [BR:cfr04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     102510298 (RAB5C)  Endosome - Lysosome transport     102510298 (RAB5C) Exosome [BR:cfr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102510298 (RAB5C)   Exosomal proteins of other body fluids (saliva and urine)    102510298 (RAB5C)   Exosomal proteins of colorectal cancer cells    102510298 (RAB5C)   Exosomal proteins of bladder cancer cells    102510298 (RAB5C) GTP-binding proteins [BR:cfr04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     102510298 (RAB5C) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  102510298 NCBI-ProteinID:  XP_032313099 UniProt:  S9Y4I1 LinkDB All DBs Position 16:complement(35272486..35293292) Genome browser AA seq 216 aa AA seqDB search MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ RQASPNIVIALAGNKADLASKRAVEFQEAQAYAEDNSLLFMETSAKTAMNVNEIFMAIAK KLPKNEPQNAAGAPGRNRGVDLQENNPASRSQCCSN NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcggggaggtgcagcgcgacccaatggaccagctgctgggaacaagatctgt cagtttaagctggtcctgctgggggagtctgcggtgggcaaatccagccttgtcctccgc tttgtcaagggacagttccacgagtaccaggagagcacaattggagcggccttcctcaca cagaccgtctgcttggacgacacaacagtcaagtttgagatctgggacacagctggacag gagcggtatcacagcctggcccccatgtactaccggggggcccaggccgccatcgtggtc tatgacatcaccaacacagatacgtttgcacgggccaagaactgggtgaaggagttacag aggcaggccagccccaacattgtcatcgcactcgcgggcaacaaggcggacctggccagc aagagagccgtggagttccaggaagcacaagcctatgcagaggacaacagtttgctgttc atggagacatcagcaaagactgcaatgaacgtgaatgaaattttcatggcaatagctaag aagcttcccaagaacgagccccagaatgcagctggtgctccgggccggaaccgaggcgtg gacctccaggagaacaacccagccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system