Camelus ferus (Wild Bactrian camel): 102510311 Help Entry 102510311         CDS       T02979                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04015   Rap1 signaling pathway cfr04810   Regulation of actin cytoskeleton cfr05014   Amyotrophic lateral sclerosis cfr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102510311 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102510311 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102510311 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102510311 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfr04131]     102510311 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cfr04812]     102510311 (PFN3)    04147 Exosome [BR:cfr04147]     102510311 (PFN3) Membrane trafficking [BR:cfr04131]  Others   Actin-binding proteins    Others     102510311 (PFN3) Cytoskeleton proteins [BR:cfr04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102510311 (PFN3) Exosome [BR:cfr04147]  Exosomal proteins   Proteins found in most exosomes    102510311 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Terminase-T7_RNaseH-like Motif Other DBs NCBI-GeneID:  102510311 NCBI-ProteinID:  XP_032320882 UniProt:  A0A8B8RTA3 LinkDB All DBs Position 22:2931441..2932795 Genome browser AA seq 137 aa AA seqDB search MGDWKVYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRRTFL QAGLSVAGRRCCVIRDHLLAEGDGVLDARTKGLDGRAVCVGHTPRALLVLMGRRGVHGGV LNKTMHELIHGLRMQGS NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggagactggaaagtctacatcagcgcggtgctgcgggaccagcgcatcgacgacgtg gctatcgtgggccactcggacaatcgctgcgtgtgggcatcgcggcccgggggcctgctg gcggccatctcaccgcaggaggtgggtgtgctcacggggccggatcggcgcaccttcctg caggccggcctgagcgtggcggggcgccgctgctgcgtcatccgcgaccacctgctggcc gagggcgacggagtgctggacgcgcgcaccaaggggctggacgggcgcgccgtctgcgtt ggccacacgccgcgtgcgctcctcgtgctcatgggccgacggggcgttcacgggggcgtt ctcaacaagacgatgcacgagctgatccacgggttgcgaatgcagggcagctag

DBGET integrated database retrieval system