Camelus ferus (Wild Bactrian camel): 102510547 Help Entry 102510547         CDS       T02979                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04613   Neutrophil extracellular trap formation cfr05034   Alcoholism cfr05202   Transcriptional misregulation in cancer cfr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cfr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102510547  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102510547   09163 Immune disease    05322 Systemic lupus erythematosus     102510547   09165 Substance dependence    05034 Alcoholism     102510547  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfr03036]     102510547   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfr04147]     102510547 Chromosome and associated proteins [BR:cfr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102510547 Exosome [BR:cfr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102510547 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF Motif Other DBs NCBI-GeneID:  102510547 NCBI-ProteinID:  XP_032333247 UniProt:  S9XPU3 LinkDB All DBs Position 3:complement(115921657..115931176) Genome browser AA seq 136 aa AA seqDB search MVRTKQTARKSTGGKAPRKRLDAKVARKSAPATCGMKRPHRFRPGTVTLREIRRFQKSTQ LLIRKLPFQRLVREITQDFIADLRLQTSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDMRLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggttcgcacgaagcagacggcgcgcaagtctacaggcggcaaggcaccacgcaagcgg ttggacgctaaggtggctcgtaagagcgcacctgctacctgtggcatgaaaaggcctcac cggtttcggcccggcactgtaacgctgcgcgagatccgccgcttccagaagtccacgcag ctgctcatccgcaagctgccgttccagcggctggtgcgggagattacccaggacttcata gcggatctgcgtcttcagacctcagctgtgatggcgctgcaggaagcgtgtgaggcctat ctggtgggtctttttgaagacaccaatttgtgtgccatccacgccaagcgtgtaactatc atgcctaaagacatgcggttggcaaggcgtatccgtggcgagcgtgcttaa

DBGET integrated database retrieval system