Camelus ferus (Wild Bactrian camel): 102511026 Help Entry 102511026         CDS       T02979                                  Name (RefSeq) histone H2B type 3-B   KO K11252   histone H2B Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04613   Neutrophil extracellular trap formation cfr05034   Alcoholism cfr05203   Viral carcinogenesis cfr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cfr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102511026  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102511026   09163 Immune disease    05322 Systemic lupus erythematosus     102511026   09165 Substance dependence    05034 Alcoholism     102511026  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfr03036]     102511026   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfr04147]     102511026 Chromosome and associated proteins [BR:cfr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102511026 Exosome [BR:cfr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102511026 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa ARM_TT21 LonB_AAA-LID CENP-T_C Motif Other DBs NCBI-GeneID:  102511026 NCBI-ProteinID:  XP_014410394 UniProt:  A0A8B7K6K4 LinkDB All DBs Position 3:115947462..115948749 Genome browser AA seq 126 aa AA seqDB search MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccagatccgtccaaatcggctcctgcacccaagaagggttctaagaaggctgtcacc aaggcgcagaagaaggacggcaagaagcgtaagcgtagccgtaaggagagctattccatc tacgtgtataaggtgctgaagcaggtgcatcccgacaccggcatctcttccaaggccatg ggtatcatgaactccttcgtcaacgacatcttcgagcgcatcgccagcgaggcttcccgc ttggcgcactataacaagcgctctaccatcacgtcccgggaggtgcagacagccgtgcgc ctgctgttgcctggcgagctagccaaacacgccgtgtccgaaggtaccaaggccgtcacc aaatacaccagctccaagtga

DBGET integrated database retrieval system