Camelus ferus (Wild Bactrian camel): 102511452 Help Entry 102511452         CDS       T02979                                  Symbol NPY Name (RefSeq) pro-neuropeptide Y   KO K05232   neuropeptide Y Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04024   cAMP signaling pathway cfr04080   Neuroactive ligand-receptor interaction cfr04920   Adipocytokine signaling pathway cfr04923   Regulation of lipolysis in adipocytes cfr05034   Alcoholism Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     102511452 (NPY)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102511452 (NPY)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     102511452 (NPY)    04920 Adipocytokine signaling pathway     102511452 (NPY)  09160 Human Diseases   09165 Substance dependence    05034 Alcoholism     102511452 (NPY)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfr04052]     102511452 (NPY) Cytokines and neuropeptides [BR:cfr04052]  Neuropeptides   GPCR binding    102511452 (NPY) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  102511452 NCBI-ProteinID:  XP_032339738 UniProt:  A0A8B8TD43 LinkDB All DBs Position 7:complement(45671553..45678981) Genome browser AA seq 97 aa AA seqDB search MLGSKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDLARYYSALRHYINLIT RQRYGKRSSPETLIADLLMRENTENGPRTRLEDPSMW NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgctgggtagcaagcgactggggctgtccggactgaccctcgccctgtccctgctcgtg tgtctgggcgcgcttgccgaggcgtacccctccaagcctgacaatcctggggaggacgcg ccagcggaggacttggccagatactactccgcgttgcgacactacataaatctcatcacc aggcagagatatggaaaacgatctagccctgagacactgattgcagacctcctgatgaga gaaaacacagaaaatggtcccagaactaggctggaagacccttccatgtggtga

DBGET integrated database retrieval system