Camelus ferus (Wild Bactrian camel): 102512073 Help Entry 102512073         CDS       T02979                                  Name (RefSeq) ferritin light chain isoform X1   KO K02159   apoptosis regulator BAX Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr01521   EGFR tyrosine kinase inhibitor resistance cfr01522   Endocrine resistance cfr01524   Platinum drug resistance cfr04071   Sphingolipid signaling pathway cfr04115   p53 signaling pathway cfr04141   Protein processing in endoplasmic reticulum cfr04210   Apoptosis cfr04211   Longevity regulating pathway cfr04215   Apoptosis - multiple species cfr04217   Necroptosis cfr04722   Neurotrophin signaling pathway cfr04932   Non-alcoholic fatty liver disease cfr04933   AGE-RAGE signaling pathway in diabetic complications cfr05012   Parkinson disease cfr05014   Amyotrophic lateral sclerosis cfr05016   Huntington disease cfr05020   Prion disease cfr05022   Pathways of neurodegeneration - multiple diseases cfr05132   Salmonella infection cfr05152   Tuberculosis cfr05160   Hepatitis C cfr05161   Hepatitis B cfr05162   Measles cfr05163   Human cytomegalovirus infection cfr05164   Influenza A cfr05165   Human papillomavirus infection cfr05166   Human T-cell leukemia virus 1 infection cfr05167   Kaposi sarcoma-associated herpesvirus infection cfr05168   Herpes simplex virus 1 infection cfr05169   Epstein-Barr virus infection cfr05170   Human immunodeficiency virus 1 infection cfr05200   Pathways in cancer cfr05202   Transcriptional misregulation in cancer cfr05203   Viral carcinogenesis cfr05210   Colorectal cancer cfr05212   Pancreatic cancer cfr05213   Endometrial cancer cfr05214   Glioma cfr05216   Thyroid cancer cfr05217   Basal cell carcinoma cfr05218   Melanoma cfr05220   Chronic myeloid leukemia cfr05222   Small cell lung cancer cfr05223   Non-small cell lung cancer cfr05224   Breast cancer cfr05225   Hepatocellular carcinoma cfr05226   Gastric cancer cfr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cfr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102512073  09130 Environmental Information Processing   09132 Signal transduction    04071 Sphingolipid signaling pathway     102512073  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102512073    04215 Apoptosis - multiple species     102512073    04217 Necroptosis     102512073    04115 p53 signaling pathway     102512073  09150 Organismal Systems   09156 Nervous system    04722 Neurotrophin signaling pathway     102512073   09149 Aging    04211 Longevity regulating pathway     102512073  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102512073    05202 Transcriptional misregulation in cancer     102512073    05203 Viral carcinogenesis     102512073   09162 Cancer: specific types    05210 Colorectal cancer     102512073    05212 Pancreatic cancer     102512073    05225 Hepatocellular carcinoma     102512073    05226 Gastric cancer     102512073    05214 Glioma     102512073    05216 Thyroid cancer     102512073    05220 Chronic myeloid leukemia     102512073    05217 Basal cell carcinoma     102512073    05218 Melanoma     102512073    05213 Endometrial cancer     102512073    05224 Breast cancer     102512073    05222 Small cell lung cancer     102512073    05223 Non-small cell lung cancer     102512073   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102512073    05170 Human immunodeficiency virus 1 infection     102512073    05161 Hepatitis B     102512073    05160 Hepatitis C     102512073    05164 Influenza A     102512073    05162 Measles     102512073    05168 Herpes simplex virus 1 infection     102512073    05163 Human cytomegalovirus infection     102512073    05167 Kaposi sarcoma-associated herpesvirus infection     102512073    05169 Epstein-Barr virus infection     102512073    05165 Human papillomavirus infection     102512073   09171 Infectious disease: bacterial    05132 Salmonella infection     102512073    05152 Tuberculosis     102512073   09164 Neurodegenerative disease    05012 Parkinson disease     102512073    05014 Amyotrophic lateral sclerosis     102512073    05016 Huntington disease     102512073    05020 Prion disease     102512073    05022 Pathways of neurodegeneration - multiple diseases     102512073   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102512073   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     102512073    04933 AGE-RAGE signaling pathway in diabetic complications     102512073   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102512073    01524 Platinum drug resistance     102512073    01522 Endocrine resistance     102512073  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:cfr03029]     102512073   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:cfr02000]     102512073 Mitochondrial biogenesis [BR:cfr03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Fission and Fusion factors     102512073 Transporters [BR:cfr02000]  Other transporters   Pores ion channels [TC:1]    102512073 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin ANAPC4 Motif Other DBs NCBI-GeneID:  102512073 NCBI-ProteinID:  XP_032341478 UniProt:  A0A8B8TI75 LinkDB All DBs Position 9:complement(13342656..13351480) Genome browser AA seq 324 aa AA seqDB search MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQIPQDASTKKLS ECLKRIGDELDSNMELQRCALALGGPADLSLASTVFGRNRPRGRPLLQPPTTLQPFFQSH PSEPATVLSSASGTSQHRFVSLTPYYGSTMSSQIRQNYSSEVEASVNHLVNMHLRASYTY LSLGFYFDRDDVALEGVGHFFRELAEEKREGAERLLKMQNQRGGRALFQDVQKPSQDEWG KTQDAMEAAIALEKNLNQALLDLHALGSARADPHLCDFLENHFLDEEVKLIKKMGDHLTN LRRLSGPQAGLGEYLFERLTLKHD NT seq 975 nt NT seq  +upstreamnt  +downstreamnt atggacgggtccggggagcaacccagaggcggggggcccaccagctctgagcagatcatg aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatgggggga gagacacctgagctgggcctggagcagattccccaggatgcgtccaccaagaagctgagc gagtgtctcaagcgcatcggagatgaactcgacagtaacatggagttgcagaggtgtgct cttgcgctcggcggtcctgcggatctgtctcttgcttcaacagtgtttggacggaacaga cccaggggacgccccttgctccagcctccgaccacccttcaaccttttttccagtcgcat ccttcagaaccagccactgtgctatcttcagcctctgggaccagccaacaccgttttgtg agcttaactccttattacggatcaaccatgagctcccagattcgtcagaattattccagc gaggttgaggcctctgtcaaccacctggtcaacatgcatctgcgggcctcctacacctac ctctctctgggcttctatttcgaccgcgacgatgtggctctggagggtgttggccacttt ttccgcgaattggctgaggagaagcgcgagggcgcggagcgtctcttgaaaatgcaaaac cagcgcggcggccgcgccctcttccaggacgtgcagaagccatctcaagatgagtggggt aaaacccaggatgctatggaagctgctattgccctggagaagaacctgaaccaggccctt ttggatctgcatgccctgggttctgcccgcgcagacccacatctctgtgacttcctggag aaccacttcctggatgaggaggtgaaactcatcaagaagatgggcgaccacctgactaac ctccgcaggctctctggtccccaggctggtctgggcgagtatctcttcgaaaggctcacc ctcaagcacgactag

DBGET integrated database retrieval system