Camelus ferus (Wild Bactrian camel): 102512333 Help Entry 102512333         CDS       T02979                                  Name (RefSeq) interferon alpha-1-like   KO K05414   interferon alpha Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04060   Cytokine-cytokine receptor interaction cfr04151   PI3K-Akt signaling pathway cfr04217   Necroptosis cfr04620   Toll-like receptor signaling pathway cfr04621   NOD-like receptor signaling pathway cfr04622   RIG-I-like receptor signaling pathway cfr04623   Cytosolic DNA-sensing pathway cfr04630   JAK-STAT signaling pathway cfr04650   Natural killer cell mediated cytotoxicity cfr04936   Alcoholic liver disease cfr05152   Tuberculosis cfr05160   Hepatitis C cfr05161   Hepatitis B cfr05162   Measles cfr05163   Human cytomegalovirus infection cfr05164   Influenza A cfr05165   Human papillomavirus infection cfr05167   Kaposi sarcoma-associated herpesvirus infection cfr05168   Herpes simplex virus 1 infection cfr05169   Epstein-Barr virus infection cfr05170   Human immunodeficiency virus 1 infection cfr05171   Coronavirus disease - COVID-19 cfr05200   Pathways in cancer cfr05320   Autoimmune thyroid disease cfr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102512333    04151 PI3K-Akt signaling pathway     102512333   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102512333  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102512333  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102512333    04621 NOD-like receptor signaling pathway     102512333    04622 RIG-I-like receptor signaling pathway     102512333    04623 Cytosolic DNA-sensing pathway     102512333    04650 Natural killer cell mediated cytotoxicity     102512333  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102512333   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102512333    05161 Hepatitis B     102512333    05160 Hepatitis C     102512333    05171 Coronavirus disease - COVID-19     102512333    05164 Influenza A     102512333    05162 Measles     102512333    05168 Herpes simplex virus 1 infection     102512333    05163 Human cytomegalovirus infection     102512333    05167 Kaposi sarcoma-associated herpesvirus infection     102512333    05169 Epstein-Barr virus infection     102512333    05165 Human papillomavirus infection     102512333   09171 Infectious disease: bacterial    05152 Tuberculosis     102512333   09163 Immune disease    05320 Autoimmune thyroid disease     102512333   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102512333   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102512333  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfr04052]     102512333 Cytokines and neuropeptides [BR:cfr04052]  Cytokines   Interferons    102512333 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  102512333 NCBI-ProteinID:  XP_032333498 UniProt:  A0A8B8SUM9 LinkDB All DBs Position 4:17437287..17437922 Genome browser AA seq 184 aa AA seqDB search MARPLSVLMALVALSFDSICSLGCDLPQTHSLATRRTLVLLGQMRRISPSSCLKDRQDFG FPQEVLGGHRLQKAQAISVFHELVQQLFLLFSTEGSSAAWEDSLLHRLCTGLDQQLTELE ACPKQEAELQGRPLLNEDPILAVRRYFHRITLYLQEKKYSPCAWEIVRAEVMRSFSSARH LQER NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atggctcgacccttgtctgtactcatggccctggtggcgctcagcttcgactccatctgc tctctgggctgtgacctgcctcagacccacagcctggccaccaggaggaccttggtgctc ctgggacaaatgaggagaatctccccctcctcctgcctgaaggacagacaggactttgga ttccctcaggaggtccttggtggccaccggctccagaaggctcaagccatctctgtcttc catgagctggtccagcagctcttcctcctcttcagcacagagggctcgtctgctgcctgg gaggacagcctcctgcacagactctgcactgggcttgatcagcagctgacggagctggaa gcctgtccgaagcaggaggcggagctgcaagggcgtcccctgctgaatgaggaccccatc ctggctgtgaggagatacttccacagaatcactctctatctgcaagagaagaaatacagc ccttgtgcctgggagatcgtcagagcagaagtcatgagatccttctcttcagcgagacac ttgcaagaaagatga

DBGET integrated database retrieval system