Camelus ferus (Wild Bactrian camel): 102512763 Help Entry 102512763         CDS       T02979                                  Symbol PFN1 Name (RefSeq) LOW QUALITY PROTEIN: profilin-1   KO K05759   profilin Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04015   Rap1 signaling pathway cfr04810   Regulation of actin cytoskeleton cfr05014   Amyotrophic lateral sclerosis cfr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102512763 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102512763 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102512763 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102512763 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfr04131]     102512763 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cfr04812]     102512763 (PFN1)    04147 Exosome [BR:cfr04147]     102512763 (PFN1) Membrane trafficking [BR:cfr04131]  Others   Actin-binding proteins    Others     102512763 (PFN1) Cytoskeleton proteins [BR:cfr04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102512763 (PFN1) Exosome [BR:cfr04147]  Exosomal proteins   Proteins found in most exosomes    102512763 (PFN1) SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  102512763 NCBI-ProteinID:  XP_032354454 UniProt:  A0A8B8UIS4 LinkDB All DBs Position 16:11230987..11233813 Genome browser AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMXSHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctataaggactcgccctccgtctgggccgccgtccccgggaaaaccttc gttaacatcacgcctgctgaggttggtgtcctggttggcaaagaccggtcaagttttttc gtgaatgggctaacgcttgggggccagaaatgttctgtgatccgggactcactgctgcag gacggggaatttaccatggatcttcgtaccaagagcacgggcggagctcccaccttcaac atcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtatgatcaacaagaaatgttatgaaatgngctctcacctgcggcgttcccagtac tga

DBGET integrated database retrieval system