Camelus ferus (Wild Bactrian camel): 102512881 Help Entry 102512881         CDS       T02979                                  Symbol C11H10orf99 Name (RefSeq) protein GPR15L   KO K25387   protein GPR15L Organism cfr  Camelus ferus (Wild Bactrian camel) Brite KEGG Orthology (KO) [BR:cfr00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfr04052]     102512881 (C11H10orf99) Cytokines and neuropeptides [BR:cfr04052]  Cytokines   Chemokines    102512881 (C11H10orf99) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GPR15L Motif Other DBs NCBI-GeneID:  102512881 NCBI-ProteinID:  XP_006174059 UniProt:  A0A8B6Y5S4 LinkDB All DBs Position 11:57760164..57767258 Genome browser AA seq 81 aa AA seqDB search MRFPALTSLLCILLLCLSIFSVEGRRHARHPAKPGRGRPCCPRGPSPDLMAQKGHHVRNC RPCKLKTKPHFWVVPGALPQV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaggtttccagccctcaccagcttgctatgtatcttgcttctctgtttgtccatcttc tctgtggaagggagaaggcatgcgaggcaccctgccaagcctggaagaggcaggccctgc tgtccccgaggtcctagcccagacctgatggctcagaaaggacaccatgtgaggaactgc agaccatgcaagctcaagacaaagccgcacttttgggtggtgcctggggcgctcccacaa gtgtag

DBGET integrated database retrieval system