Camelus ferus (Wild Bactrian camel): 102513132 Help Entry 102513132         CDS       T02979                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04613   Neutrophil extracellular trap formation cfr05034   Alcoholism cfr05202   Transcriptional misregulation in cancer cfr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cfr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102513132  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102513132   09163 Immune disease    05322 Systemic lupus erythematosus     102513132   09165 Substance dependence    05034 Alcoholism     102513132  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfr03036]     102513132   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfr04147]     102513132 Chromosome and associated proteins [BR:cfr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102513132 Exosome [BR:cfr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102513132 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  102513132 NCBI-ProteinID:  XP_006176524 UniProt:  T0MJ22 LinkDB All DBs Position 16:24646821..24649221 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgaaccaagcagactgctcgtaagtccacgggtgggaaagcgccccgcaaacag ctggccactaaagctgccagaaaaagcgctccctctaccggcggggtgaaaaagcctcat cgctacaggcccgggaccgttgcgcttcgagaaatccgtcgttaccagaaatcgaccgag cttctgatccggaagcttcctttccagaggttggtgagggaaatcgcccaggatttcaaa actgacttgaggttccagagtgccgccattggtgcgctccaggaggctagtgaagcgtac ctggtgggtttatttgaagatactaatctgtgtgccatccacgctaagagagtcaccatc atgcccaaagacatccagttggctcgtcggatacggggagagagagcttaa

DBGET integrated database retrieval system