Camelus ferus (Wild Bactrian camel): 102513610 Help Entry 102513610         CDS       T02979                                  Symbol BRK1 Name (RefSeq) protein BRICK1 isoform X1   KO K05752   chromosome 3 open reading frame 10 Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04810   Regulation of actin cytoskeleton cfr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cfr00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102513610 (BRK1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102513610 (BRK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  102513610 NCBI-ProteinID:  XP_006173393 UniProt:  A0A8B6Y9C7 LinkDB All DBs Position 17:34654309..34660404 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcgggacaagaggacccggtgcagcgggagattcaccaggactgggcgaaccgggag tacattgaggtcatcaccagcagcatcaagaaaatcgcagactttctcaactcgttcgat atgtcttgccgttcaagactcgcaacactaaacgagaaattgacagctcttgaacggaga atagagtacattgaagccagggtgacaaaaggtgagaccctcacctag

DBGET integrated database retrieval system