Camelus ferus (Wild Bactrian camel): 102513954 Help Entry 102513954         CDS       T02979                                  Symbol CSNK2B Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr03008   Ribosome biogenesis in eukaryotes cfr03083   Polycomb repressive complex cfr04064   NF-kappa B signaling pathway cfr04137   Mitophagy - animal cfr04310   Wnt signaling pathway cfr04520   Adherens junction cfr05010   Alzheimer disease cfr05020   Prion disease cfr05022   Pathways of neurodegeneration - multiple diseases cfr05162   Measles cfr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:cfr00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     102513954 (CSNK2B)   09126 Chromosome    03083 Polycomb repressive complex     102513954 (CSNK2B)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     102513954 (CSNK2B)    04064 NF-kappa B signaling pathway     102513954 (CSNK2B)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     102513954 (CSNK2B)   09144 Cellular community - eukaryotes    04520 Adherens junction     102513954 (CSNK2B)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102513954 (CSNK2B)   09172 Infectious disease: viral    05162 Measles     102513954 (CSNK2B)   09164 Neurodegenerative disease    05010 Alzheimer disease     102513954 (CSNK2B)    05020 Prion disease     102513954 (CSNK2B)    05022 Pathways of neurodegeneration - multiple diseases     102513954 (CSNK2B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:cfr03009]     102513954 (CSNK2B)    03036 Chromosome and associated proteins [BR:cfr03036]     102513954 (CSNK2B) Ribosome biogenesis [BR:cfr03009]  Eukaryotic type   90S particles    Kinase     102513954 (CSNK2B) Chromosome and associated proteins [BR:cfr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      102513954 (CSNK2B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  102513954 NCBI-ProteinID:  XP_006178830 UniProt:  A0A8B8RMN4 LinkDB All DBs Position 20:20690683..20694764 Genome browser AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagcagctcagaggaggtgtcctggatttcctggttctgtgggctccgtggcaatgaa ttcttctgtgaagtggatgaagactacatccaggacaaattcaatctcactggactcaat gagcaggtgcctcactatcgtcaagctctagacatgatcttggacctggagcctgatgag gagctggaagacaaccccaaccagagcgacctgattgagcaggcagccgaaatgctctat ggattgatccacgcccgctacatcctcaccaaccgtggcatcgcccagatgttggaaaag taccagcagggagactttggctactgtccccgtgtgtactgtgagaaccagccaatgctt cccatcggcctttcggacatcccaggtgaggccatggtgaagctctactgccccaagtgc atggacgtgtacacacccaagtcatcgaggcaccaccacacggacggcgcctacttcggc accggtttccctcacatgctcttcatggtgcaccccgagtaccggcccaagcggcccgcc aaccagtttgtgcccaggctctacggtttcaagattcatccgatggcctaccagctgcag ctccaagccgccagcaacttcaagagcccagtcaagacgattcgctga

DBGET integrated database retrieval system