Camelus ferus (Wild Bactrian camel): 102514212 Help Entry 102514212         CDS       T02979                                  Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04519   Cadherin signaling cfr04810   Regulation of actin cytoskeleton cfr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04519 Cadherin signaling     102514212  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102514212  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102514212 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CCDC53 Motif Other DBs NCBI-GeneID:  102514212 NCBI-ProteinID:  XP_032344268 UniProt:  A0A8B8TQY2 LinkDB All DBs Position 10:complement(13697642..13698489) Genome browser AA seq 67 aa AA seqDB search MVGQEDPVQREIHQDWANREYSEVITSSIMTITDFLNLFDMSCRSRLATLNETLTALERR IEYIEAR NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggtgggacaagaggacccagtgcagcgggagatccaccaggactgggcgaaccgggag tacagtgaggtcatcaccagcagcatcatgacaatcacagactttctcaacttattcgat atgtcttgccgttcaagactcgcaacactaaacgagacattgacagctcttgaacggaga atagagtacattgaagccaggtga

DBGET integrated database retrieval system