Camelus ferus (Wild Bactrian camel): 102514844 Help Entry 102514844         CDS       T02979                                  Name (RefSeq) T cell receptor alpha variable 2   KO K10784   T cell receptor alpha chain V region Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04014   Ras signaling pathway cfr04015   Rap1 signaling pathway cfr04020   Calcium signaling pathway cfr04064   NF-kappa B signaling pathway cfr04514   Cell adhesion molecules cfr04612   Antigen processing and presentation cfr04658   Th1 and Th2 cell differentiation cfr04659   Th17 cell differentiation cfr04660   T cell receptor signaling pathway cfr04672   Intestinal immune network for IgA production cfr04940   Type I diabetes mellitus cfr05135   Yersinia infection cfr05142   Chagas disease cfr05144   Malaria cfr05150   Staphylococcus aureus infection cfr05162   Measles cfr05166   Human T-cell leukemia virus 1 infection cfr05169   Epstein-Barr virus infection cfr05170   Human immunodeficiency virus 1 infection cfr05202   Transcriptional misregulation in cancer cfr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer cfr05310   Asthma cfr05320   Autoimmune thyroid disease cfr05321   Inflammatory bowel disease cfr05322   Systemic lupus erythematosus cfr05323   Rheumatoid arthritis cfr05330   Allograft rejection cfr05332   Graft-versus-host disease cfr05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102514844    04015 Rap1 signaling pathway     102514844    04064 NF-kappa B signaling pathway     102514844    04020 Calcium signaling pathway     102514844   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102514844  09150 Organismal Systems   09151 Immune system    04612 Antigen processing and presentation     102514844    04660 T cell receptor signaling pathway     102514844    04658 Th1 and Th2 cell differentiation     102514844    04659 Th17 cell differentiation     102514844    04672 Intestinal immune network for IgA production     102514844  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102514844    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102514844   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102514844    05170 Human immunodeficiency virus 1 infection     102514844    05162 Measles     102514844    05169 Epstein-Barr virus infection     102514844   09171 Infectious disease: bacterial    05135 Yersinia infection     102514844    05150 Staphylococcus aureus infection     102514844   09174 Infectious disease: parasitic    05144 Malaria     102514844    05142 Chagas disease     102514844   09163 Immune disease    05310 Asthma     102514844    05322 Systemic lupus erythematosus     102514844    05323 Rheumatoid arthritis     102514844    05320 Autoimmune thyroid disease     102514844    05321 Inflammatory bowel disease     102514844    05330 Allograft rejection     102514844    05332 Graft-versus-host disease     102514844   09166 Cardiovascular disease    05416 Viral myocarditis     102514844   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102514844 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  V-set I-set Ig_3 Motif Other DBs NCBI-GeneID:  102514844 NCBI-ProteinID:  XP_032337556 LinkDB All DBs Position 6:30968648..30969326 Genome browser AA seq 119 aa AA seqDB search MALRSTLEVVRLGLLLSSLWKVAESKDQVFQPSTVVTSEGAMAEIYCNHSISNAYNFFWY LHFPGCAPRLLIQGSKPSHQGRYNMTYERLSSSLLIPQVRLADAAVYYCGLANTGAGNP NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggctttgcggagcactctggaagtagtgcggctggggctcctcctcagctctctctgg aaggttgcagagagcaaggaccaagtatttcagccttccaccgtggtaacttcagaggga gccatggcagaaatctactgtaatcactctatatccaatgcttacaacttcttctggtac cttcacttcccaggatgtgcaccaaggcttcttattcagggctccaagccttcccatcag ggacgctacaacatgacttacgagcggctctcctcatcactgctcatcccccaggtgcgg ttggcagatgctgctgtttactactgtggtctggcaaacacaggggcagggaacccgtaa

DBGET integrated database retrieval system