Camelus ferus (Wild Bactrian camel): 102514894 Help Entry 102514894         CDS       T02979                                  Symbol IL2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04060   Cytokine-cytokine receptor interaction cfr04061   Viral protein interaction with cytokine and cytokine receptor cfr04151   PI3K-Akt signaling pathway cfr04625   C-type lectin receptor signaling pathway cfr04630   JAK-STAT signaling pathway cfr04658   Th1 and Th2 cell differentiation cfr04659   Th17 cell differentiation cfr04660   T cell receptor signaling pathway cfr04672   Intestinal immune network for IgA production cfr04940   Type I diabetes mellitus cfr05135   Yersinia infection cfr05142   Chagas disease cfr05162   Measles cfr05166   Human T-cell leukemia virus 1 infection cfr05171   Coronavirus disease - COVID-19 cfr05200   Pathways in cancer cfr05320   Autoimmune thyroid disease cfr05321   Inflammatory bowel disease cfr05330   Allograft rejection cfr05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102514894 (IL2)    04151 PI3K-Akt signaling pathway     102514894 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102514894 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     102514894 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102514894 (IL2)    04660 T cell receptor signaling pathway     102514894 (IL2)    04658 Th1 and Th2 cell differentiation     102514894 (IL2)    04659 Th17 cell differentiation     102514894 (IL2)    04672 Intestinal immune network for IgA production     102514894 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102514894 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102514894 (IL2)    05171 Coronavirus disease - COVID-19     102514894 (IL2)    05162 Measles     102514894 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     102514894 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     102514894 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     102514894 (IL2)    05321 Inflammatory bowel disease     102514894 (IL2)    05330 Allograft rejection     102514894 (IL2)    05332 Graft-versus-host disease     102514894 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102514894 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfr04052]     102514894 (IL2)    00536 Glycosaminoglycan binding proteins [BR:cfr00536]     102514894 (IL2) Cytokines and neuropeptides [BR:cfr04052]  Cytokines   Interleukins    102514894 (IL2) Glycosaminoglycan binding proteins [BR:cfr00536]  Heparan sulfate / Heparin   Cytokines    102514894 (IL2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL2 Baculo_PEP_C DUF7037 Motif Other DBs NCBI-GeneID:  102514894 NCBI-ProteinID:  XP_006180770 UniProt:  A0A8B6YD32 LinkDB All DBs Position 2:complement(86648908..86655223) Genome browser AA seq 154 aa AA seqDB search MYKLQFLSCIALTLALVANSAPTLSSTKDTKKQLEPLLLDLQFLLKEVNNYENLKLSRML TFKFYMPKKATELKHLQCLMEELKPLEEVLNLAQSKNSHLTNIKDSMNNINLTVSELKGS ETGFTCEYDDETVTVVEFLNKWITFCQSIYSTLT NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgtacaagctgcaattcttgtcttgcattgcactaactcttgcactcgtagcaaacagt gcacctactttgagctctacgaaggacacaaagaaacaactggagccactgttgctggat ttacagtttcttttgaaggaagttaataactatgagaacctcaaactctccaggatgctc acatttaaattttacatgcccaagaaggctacagaattgaaacaccttcagtgtctcatg gaagaactcaaacctttggaggaagtgctaaatttagctcaaagcaaaaactctcacctg acaaatatcaaggactcaatgaacaatatcaatttaacggtttcggaactgaagggatct gaaacaggattcacatgtgaatatgatgatgagacagtaactgttgtagaatttctgaac aaatggattaccttttgccaaagtatctactcaacactgacttga

DBGET integrated database retrieval system