Camelus ferus (Wild Bactrian camel): 102515139 Help Entry 102515139         CDS       T02979                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04014   Ras signaling pathway cfr04137   Mitophagy - animal cfr04144   Endocytosis cfr04145   Phagosome cfr04148   Efferocytosis cfr04962   Vasopressin-regulated water reabsorption cfr05014   Amyotrophic lateral sclerosis cfr05022   Pathways of neurodegeneration - multiple diseases cfr05132   Salmonella infection cfr05146   Amoebiasis cfr05152   Tuberculosis Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102515139 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102515139 (RAB5A)    04145 Phagosome     102515139 (RAB5A)    04137 Mitophagy - animal     102515139 (RAB5A)    04148 Efferocytosis     102515139 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     102515139 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102515139 (RAB5A)    05152 Tuberculosis     102515139 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     102515139 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102515139 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     102515139 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfr04131]     102515139 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfr04147]     102515139 (RAB5A)    04031 GTP-binding proteins [BR:cfr04031]     102515139 (RAB5A) Membrane trafficking [BR:cfr04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     102515139 (RAB5A)  Endosome - Lysosome transport     102515139 (RAB5A) Exosome [BR:cfr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102515139 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    102515139 (RAB5A)   Exosomal proteins of colorectal cancer cells    102515139 (RAB5A)   Exosomal proteins of bladder cancer cells    102515139 (RAB5A) GTP-binding proteins [BR:cfr04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     102515139 (RAB5A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase MCR_beta AAA_16 BrnT_toxin Motif Other DBs NCBI-GeneID:  102515139 NCBI-ProteinID:  XP_032344633 UniProt:  A0A8B8TRY6 LinkDB All DBs Position 1:complement(116407771..116435733) Genome browser AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQAYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtctgctgttggcaaatcaagcctagtgcttcgtttt gtgaagggccaatttcatgaatttcaagagagtaccatcggggctgcttttctaacccaa accgtgtgtcttgatgacacaacggtaaagtttgagatatgggatacagctggtcaagaa cggtaccatagcctagcaccgatgtactacagaggagcacaagcagccatagttgtgtac gatatcacaaatgaggagtcttttgccagagccaaaaactgggttaaagaacttcagagg caagccagtcctaacattgtaatagctttatcaggaaataaggctgacctcgcaaataaa agagctgtggacttccaggaagcacaggcctatgcagatgacaacagtttattatttatg gagacatcggctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaag ttgccaaagaatgaaccacagaatccaggagcaaattctgccagaggaagaggagtagac cttactgaacccacacagccaaccaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system