Camelus ferus (Wild Bactrian camel): 102515405 Help Entry 102515405         CDS       T02979                                  Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04810   Regulation of actin cytoskeleton cfr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cfr00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102515405  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102515405 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LXG TPR_Sec16 Motif Other DBs NCBI-GeneID:  102515405 NCBI-ProteinID:  XP_032330559 UniProt:  A0A8B8SK02 LinkDB All DBs Position X:complement(43547807..43548827) Genome browser AA seq 87 aa AA seqDB search MDLQIAFGSAAAKAGQEDLVQQEIHQDWVNREYIEVITSSIKKLADSLNSFDMPCCSRLA TLNKRLTALQWKIKYVQAWVTKGETLT NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggatctgcagattgccttcggtagtgcagcagccaaggcaggacaagaggacctggtg cagcaggagatccaccaggactgggtgaaccgggagtacattgaggtcatcaccagcagc atcaagaaactcgcagactctctcaactcgttcgatatgccttgctgttcaagactagca acactaaacaagagattgacagctcttcaatggaaaattaagtatgttcaagcctgggtg acaaaaggtgagaccctcacgtag

DBGET integrated database retrieval system