Camelus ferus (Wild Bactrian camel): 102515743 Help Entry 102515743         CDS       T02979                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04081   Hormone signaling cfr04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     102515743 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     102515743 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfr04052]     102515743 (GAST) Cytokines and neuropeptides [BR:cfr04052]  Neuropeptides   GPCR binding    102515743 (GAST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  102515743 NCBI-ProteinID:  XP_006178759 UniProt:  S9XCX3 LinkDB All DBs Position 16:50037619..50038514 Genome browser AA seq 104 aa AA seqDB search MQRLCAFALILVLALAASSEASWKPSSQLQEAPLAPGANRGQEQHGLDRLGPASHHRRQL GLEAPPHLVADLSKKQGPWLEEEEEAYGWMDFGRRSAEEGDQHP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcgactgtgtgcgtttgccctgatcttggtgctggctctggctgcctcctccgaa gcttcttggaagcccagctcccagttgcaggaggcacctttggctccaggggccaataga ggccaggagcagcatgggctggaccggctgggcccagcctctcaccaccgaaggcagctg gggcttgaggctcccccacatctggtggcagacctgtctaagaagcaggggccatggctg gaggaagaagaagaagcatatggatggatggacttcggccgccgcagtgctgaggaaggg gaccaacatccttag

DBGET integrated database retrieval system