Camelus ferus (Wild Bactrian camel): 102515871 Help Entry 102515871         CDS       T02979                                  Symbol PPY Name (RefSeq) pancreatic prohormone   KO K05234   pancreatic polypeptide Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04080   Neuroactive ligand-receptor interaction Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102515871 (PPY)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfr04052]     102515871 (PPY) Cytokines and neuropeptides [BR:cfr04052]  Neuropeptides   GPCR binding    102515871 (PPY) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  102515871 NCBI-ProteinID:  XP_006174283 UniProt:  S9XLC1 LinkDB All DBs Position 16:complement(36464689..36466143) Genome browser AA seq 95 aa AA seqDB search MAAARRCLSLLLLSTCVALLLQPPLGARGAPLEPVYPGDDATPEQMAQYAAELRRYINML TRPRYGKRDKEGTLGLLDCGSPYAVAPRELSPVDS NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggccgccgcacgccgctgcctctccctgctgctcctgtccacatgtgtggctctgttg ctgcagccacccctgggtgcccggggggccccgctggagccggtctacccaggggacgat gccacgccagagcagatggcccagtatgcagctgagctccgcagatacatcaacatgctg accagacccaggtatgggaaaagagacaaagaaggcacgctgggcctcctggactgcggc tccccctatgcggtggcccccagggagctcagcccagtggactcgtga

DBGET integrated database retrieval system