Camelus ferus (Wild Bactrian camel): 102515941 Help Entry 102515941         CDS       T02979                                  Symbol ARF4 Name (RefSeq) ADP-ribosylation factor 4   KO K07939   ADP-ribosylation factor 4 Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04144   Endocytosis Brite KEGG Orthology (KO) [BR:cfr00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102515941 (ARF4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfr04131]     102515941 (ARF4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfr04147]     102515941 (ARF4)    04031 GTP-binding proteins [BR:cfr04031]     102515941 (ARF4) Membrane trafficking [BR:cfr04131]  Endosome - Golgi transport   Arf GTPases and associated proteins    Arf GTPases     102515941 (ARF4) Exosome [BR:cfr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102515941 (ARF4)   Exosomal proteins of other body fluids (saliva and urine)    102515941 (ARF4)   Exosomal proteins of colorectal cancer cells    102515941 (ARF4) GTP-binding proteins [BR:cfr04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     102515941 (ARF4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf SRPRB Roc Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K GTP_EFTU Motif Other DBs NCBI-GeneID:  102515941 NCBI-ProteinID:  XP_032314136 UniProt:  A0A8B8R822 LinkDB All DBs Position 17:19489512..19506220 Genome browser AA seq 180 aa AA seqDB search MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEGAEELQKMLQEDELRDAV LLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR NT seq 543 nt NT seq  +upstreamnt  +downstreamnt atgggcctcactatctcctccctcttctcccgcttgttcggcaagaagcagatgcgcatt ttgatggttggattggatgctgctggcaagacgaccattctgtataaactgaagttaggg gaaatagtcaccaccattcctactattggttttaatgtggaaacagtagaatataagaac atttgtttcacagtatgggatgttggtggtcaagataaaattaggcctctctggaggcat tacttccagaacacccagggtcttatttttgtggtagatagcaatgatcgtgaaagaatt caggaaggagcagaagagctgcagaaaatgcttcaggaagatgagttgcgagatgcggtg ttgctgctttttgcaaacaaacaggatttgccaaatgctatggccattagtgaaatgaca gataaattaggtcttcagtctctccgtaacagaacatggtatgttcaagccacttgtgct acacaaggaaccggtctgtatgagggacttgattggctgtcaaatgagctttcaaaacgt taa

DBGET integrated database retrieval system