Camelus ferus (Wild Bactrian camel): 102516888 Help Entry 102516888         CDS       T02979                                  Symbol CLDN1 Name (RefSeq) claudin-1   KO K06087   claudin Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr03272   Virion - Hepatitis viruses cfr04382   Cornified envelope formation cfr04514   Cell adhesion molecule (CAM) interaction cfr04530   Tight junction cfr04670   Leukocyte transendothelial migration cfr05160   Hepatitis C Brite KEGG Orthology (KO) [BR:cfr00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     102516888 (CLDN1)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     102516888 (CLDN1)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     102516888 (CLDN1)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102516888 (CLDN1)   09158 Development and regeneration    04382 Cornified envelope formation     102516888 (CLDN1)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     102516888 (CLDN1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cfr03037]     102516888 (CLDN1)    04147 Exosome [BR:cfr04147]     102516888 (CLDN1) Cilium and associated proteins [BR:cfr03037]  Other cilia and associated proteins   Stereociliary proteins    102516888 (CLDN1) Exosome [BR:cfr04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    102516888 (CLDN1)   Exosomal proteins of colorectal cancer cells    102516888 (CLDN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Voltage_CLC TMEM174 CD20 HAAS_TM DUF7702 Amastin Cytochrom_B_C DUF1218 DUF6479 Motif Other DBs NCBI-GeneID:  102516888 NCBI-ProteinID:  XP_006188927 UniProt:  S9WPQ3 LinkDB All DBs Position 1:66372625..66388465 Genome browser AA seq 211 aa AA seqDB search MANAGLQLLGFILAFLGWIGAIVSTALPQWKIYSYASDNIVTAQAIYEGLWMSCVSQSTG QIQCKVFDSLLNLHSTLQATRALMVIGILLGLIAICVATVGMKCMKCLEDDEVQKMRMAV IGGVIFLISGLAVLVATAWYGNRIVQEFYDPMTPVNARYEFGHALFTGWAAASLTLLGGA LLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggccaacgcggggctgcagctgctgggcttcatcctggccttcctgggctggatcggc gccatcgtcagcacggcgctgccccagtggaagatttactcctacgccagcgacaacatc gtaacagcccaggccatctacgagggactgtggatgtcctgcgtgtcgcagagcaccggg cagatccagtgcaaagtcttcgactccttgctgaatctacacagtactttgcaagcaacc cgcgccttgatggtgattggcatcctgctgggactgatagccatttgtgtggccactgtt ggcatgaagtgtatgaagtgcctggaagatgatgaggtgcagaagatgcggatggctgtc attgggggcgtgatatttcttatttcaggtctggccgttttagtcgccacagcgtggtat ggcaatagaattgttcaggaattctatgaccccatgaccccggtcaatgccaggtatgaa tttggacatgctctcttcactggctgggctgctgcttctctcaccctcctgggaggcgcc ctgctttgctgctcgtgtccccggaaaacaacatcttacccaacgccacggccctacccg aaacctgcgccttccagtgggaaagactatgtgtga

DBGET integrated database retrieval system