KEGG   Camelus ferus (Wild Bactrian camel): 102516893
Entry
102516893         CDS       T02979                                 
Symbol
RAC1
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1 isoform X1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04010  MAPK signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04024  cAMP signaling pathway
cfr04062  Chemokine signaling pathway
cfr04071  Sphingolipid signaling pathway
cfr04145  Phagosome
cfr04148  Efferocytosis
cfr04151  PI3K-Akt signaling pathway
cfr04310  Wnt signaling pathway
cfr04360  Axon guidance
cfr04370  VEGF signaling pathway
cfr04380  Osteoclast differentiation
cfr04510  Focal adhesion
cfr04517  IgSF CAM signaling
cfr04518  Integrin signaling
cfr04520  Adherens junction
cfr04530  Tight junction
cfr04613  Neutrophil extracellular trap formation
cfr04620  Toll-like receptor signaling pathway
cfr04650  Natural killer cell mediated cytotoxicity
cfr04662  B cell receptor signaling pathway
cfr04664  Fc epsilon RI signaling pathway
cfr04666  Fc gamma R-mediated phagocytosis
cfr04670  Leukocyte transendothelial migration
cfr04722  Neurotrophin signaling pathway
cfr04810  Regulation of actin cytoskeleton
cfr04932  Non-alcoholic fatty liver disease
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr04972  Pancreatic secretion
cfr05014  Amyotrophic lateral sclerosis
cfr05020  Prion disease
cfr05022  Pathways of neurodegeneration - multiple diseases
cfr05100  Bacterial invasion of epithelial cells
cfr05132  Salmonella infection
cfr05135  Yersinia infection
cfr05163  Human cytomegalovirus infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05169  Epstein-Barr virus infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05200  Pathways in cancer
cfr05203  Viral carcinogenesis
cfr05205  Proteoglycans in cancer
cfr05208  Chemical carcinogenesis - reactive oxygen species
cfr05210  Colorectal cancer
cfr05211  Renal cell carcinoma
cfr05212  Pancreatic cancer
cfr05231  Choline metabolism in cancer
cfr05415  Diabetic cardiomyopathy
cfr05416  Viral myocarditis
cfr05417  Lipid and atherosclerosis
cfr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102516893 (RAC1)
   04014 Ras signaling pathway
    102516893 (RAC1)
   04015 Rap1 signaling pathway
    102516893 (RAC1)
   04310 Wnt signaling pathway
    102516893 (RAC1)
   04370 VEGF signaling pathway
    102516893 (RAC1)
   04071 Sphingolipid signaling pathway
    102516893 (RAC1)
   04024 cAMP signaling pathway
    102516893 (RAC1)
   04151 PI3K-Akt signaling pathway
    102516893 (RAC1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    102516893 (RAC1)
   04518 Integrin signaling
    102516893 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102516893 (RAC1)
   04148 Efferocytosis
    102516893 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102516893 (RAC1)
   04520 Adherens junction
    102516893 (RAC1)
   04530 Tight junction
    102516893 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102516893 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102516893 (RAC1)
   04620 Toll-like receptor signaling pathway
    102516893 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    102516893 (RAC1)
   04662 B cell receptor signaling pathway
    102516893 (RAC1)
   04664 Fc epsilon RI signaling pathway
    102516893 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    102516893 (RAC1)
   04670 Leukocyte transendothelial migration
    102516893 (RAC1)
   04062 Chemokine signaling pathway
    102516893 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    102516893 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102516893 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    102516893 (RAC1)
   04380 Osteoclast differentiation
    102516893 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102516893 (RAC1)
   05205 Proteoglycans in cancer
    102516893 (RAC1)
   05208 Chemical carcinogenesis - reactive oxygen species
    102516893 (RAC1)
   05203 Viral carcinogenesis
    102516893 (RAC1)
   05231 Choline metabolism in cancer
    102516893 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102516893 (RAC1)
   05212 Pancreatic cancer
    102516893 (RAC1)
   05211 Renal cell carcinoma
    102516893 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102516893 (RAC1)
   05163 Human cytomegalovirus infection
    102516893 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102516893 (RAC1)
   05169 Epstein-Barr virus infection
    102516893 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102516893 (RAC1)
   05135 Yersinia infection
    102516893 (RAC1)
   05100 Bacterial invasion of epithelial cells
    102516893 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102516893 (RAC1)
   05020 Prion disease
    102516893 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    102516893 (RAC1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102516893 (RAC1)
   05418 Fluid shear stress and atherosclerosis
    102516893 (RAC1)
   05415 Diabetic cardiomyopathy
    102516893 (RAC1)
   05416 Viral myocarditis
    102516893 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102516893 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102516893 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfr04131]
    102516893 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfr04147]
    102516893 (RAC1)
   04031 GTP-binding proteins [BR:cfr04031]
    102516893 (RAC1)
Membrane trafficking [BR:cfr04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    102516893 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    102516893 (RAC1)
  Macropinocytosis
   Ras GTPases
    102516893 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    102516893 (RAC1)
Exosome [BR:cfr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102516893 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   102516893 (RAC1)
  Exosomal proteins of colorectal cancer cells
   102516893 (RAC1)
  Exosomal proteins of bladder cancer cells
   102516893 (RAC1)
GTP-binding proteins [BR:cfr04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    102516893 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU CagD
Other DBs
NCBI-GeneID: 102516893
NCBI-ProteinID: XP_032315921
UniProt: A0A8B8RD64
LinkDB
Position
18:complement(11847684..11868050)
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgtaggtaaaacttgcctactg
atcagttacacgaccaatgcgtttcctggagaatatatccccactgtctttgacaactac
tctgccaatgttatggtggatgggaagccggtgaacctgggcttatgggacacagctgga
caagaagactatgaccgattgcgtcccctctcctacccgcagacagacgtattcttaatt
tgcttttctcttgtgagtcctgcatcatttgaaaatgttcgtgcaaagtggtatccagag
gtgcgacaccattgtcccaacacccctatcatcctggtggggacgaagcttgatcttagg
gatgataaggacacgattgagaaactgaaggagaagaagctgaccccaatcacctaccca
cagggcttagccatggccaaggagatcggtgctgtgaaatacctggagtgctcagctctc
acgcagcgaggcctcaagacagtgtttgatgaagccatccgagcggttctctgcccgccc
cccgtcaagaagaggaagagaaaatgcctgctgttgtaa

DBGET integrated database retrieval system