Camelus ferus (Wild Bactrian camel): 102517974 Help Entry 102517974         CDS       T02979                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04140   Autophagy - animal cfr04144   Endocytosis cfr04152   AMPK signaling pathway cfr04530   Tight junction cfr04972   Pancreatic secretion cfr05014   Amyotrophic lateral sclerosis cfr05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     102517974 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102517974 (RAB8A)    04140 Autophagy - animal     102517974 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     102517974 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     102517974 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102517974 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     102517974 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfr04131]     102517974 (RAB8A)    03036 Chromosome and associated proteins [BR:cfr03036]     102517974 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfr04147]     102517974 (RAB8A)    04031 GTP-binding proteins [BR:cfr04031]     102517974 (RAB8A) Membrane trafficking [BR:cfr04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     102517974 (RAB8A)  Autophagy   Other autophagy associated proteins     102517974 (RAB8A) Chromosome and associated proteins [BR:cfr03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     102517974 (RAB8A) Exosome [BR:cfr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102517974 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    102517974 (RAB8A)   Exosomal proteins of colorectal cancer cells    102517974 (RAB8A) GTP-binding proteins [BR:cfr04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     102517974 (RAB8A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU MMR_HSR1 SRPRB DUF3963 Septin AAA_7 Motif Other DBs NCBI-GeneID:  102517974 NCBI-ProteinID:  XP_032321271 UniProt:  A0A8B8RTI9 LinkDB All DBs Position 22:complement(17643846..17662923) Genome browser AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSRERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSNQGVKITPDQQKRSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactccactttcatctccacc ataggaattgactttaaaattcggaccatagagctcgatggcaagagaattaaactacag atatgggacacagctggtcaggaacggtttcggacgatcacaacggcttactacaggggc gcgatgggcatcatgctggtctacgacatcaccaacgagaagtccttcgacaacatccgg aactggattcggaacattgaggagcacgcctctgcagatgtcgaaaagatgatactcggg aacaagtgcgacgtgaacgacaagagacaagtttccagggaacggggagagaagctggcc ctggactatggaatcaagttcatggagaccagcgcaaaggccaacatcaacgtggagaac gcatttttcactctcgccagagacatcaaagcaaaaatggataaaaaattggaaggcaac agcccccaggggagcaaccagggagtcaaaatcacaccagaccagcagaagaggagcagc tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system