KEGG   Camelus ferus (Wild Bactrian camel): 102518712
Entry
102518712         CDS       T02979                                 
Name
(RefSeq) calmodulin
  KO
K02183  calmodulin
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04020  Calcium signaling pathway
cfr04022  cGMP-PKG signaling pathway
cfr04024  cAMP signaling pathway
cfr04070  Phosphatidylinositol signaling system
cfr04114  Oocyte meiosis
cfr04218  Cellular senescence
cfr04261  Adrenergic signaling in cardiomyocytes
cfr04270  Vascular smooth muscle contraction
cfr04371  Apelin signaling pathway
cfr04625  C-type lectin receptor signaling pathway
cfr04713  Circadian entrainment
cfr04720  Long-term potentiation
cfr04722  Neurotrophin signaling pathway
cfr04728  Dopaminergic synapse
cfr04740  Olfactory transduction
cfr04744  Phototransduction
cfr04750  Inflammatory mediator regulation of TRP channels
cfr04910  Insulin signaling pathway
cfr04912  GnRH signaling pathway
cfr04915  Estrogen signaling pathway
cfr04916  Melanogenesis
cfr04921  Oxytocin signaling pathway
cfr04922  Glucagon signaling pathway
cfr04924  Renin secretion
cfr04925  Aldosterone synthesis and secretion
cfr04970  Salivary secretion
cfr04971  Gastric acid secretion
cfr05010  Alzheimer disease
cfr05012  Parkinson disease
cfr05022  Pathways of neurodegeneration - multiple diseases
cfr05031  Amphetamine addiction
cfr05034  Alcoholism
cfr05133  Pertussis
cfr05152  Tuberculosis
cfr05163  Human cytomegalovirus infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05200  Pathways in cancer
cfr05214  Glioma
cfr05417  Lipid and atherosclerosis
cfr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102518712
   04015 Rap1 signaling pathway
    102518712
   04371 Apelin signaling pathway
    102518712
   04020 Calcium signaling pathway
    102518712
   04070 Phosphatidylinositol signaling system
    102518712
   04024 cAMP signaling pathway
    102518712
   04022 cGMP-PKG signaling pathway
    102518712
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102518712
   04218 Cellular senescence
    102518712
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102518712
  09152 Endocrine system
   04910 Insulin signaling pathway
    102518712
   04922 Glucagon signaling pathway
    102518712
   04912 GnRH signaling pathway
    102518712
   04915 Estrogen signaling pathway
    102518712
   04921 Oxytocin signaling pathway
    102518712
   04916 Melanogenesis
    102518712
   04924 Renin secretion
    102518712
   04925 Aldosterone synthesis and secretion
    102518712
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102518712
   04270 Vascular smooth muscle contraction
    102518712
  09154 Digestive system
   04970 Salivary secretion
    102518712
   04971 Gastric acid secretion
    102518712
  09156 Nervous system
   04728 Dopaminergic synapse
    102518712
   04720 Long-term potentiation
    102518712
   04722 Neurotrophin signaling pathway
    102518712
  09157 Sensory system
   04744 Phototransduction
    102518712
   04740 Olfactory transduction
    102518712
   04750 Inflammatory mediator regulation of TRP channels
    102518712
  09159 Environmental adaptation
   04713 Circadian entrainment
    102518712
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102518712
  09162 Cancer: specific types
   05214 Glioma
    102518712
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102518712
   05163 Human cytomegalovirus infection
    102518712
   05167 Kaposi sarcoma-associated herpesvirus infection
    102518712
  09171 Infectious disease: bacterial
   05133 Pertussis
    102518712
   05152 Tuberculosis
    102518712
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102518712
   05012 Parkinson disease
    102518712
   05022 Pathways of neurodegeneration - multiple diseases
    102518712
  09165 Substance dependence
   05031 Amphetamine addiction
    102518712
   05034 Alcoholism
    102518712
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102518712
   05418 Fluid shear stress and atherosclerosis
    102518712
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cfr01009]
    102518712
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfr04131]
    102518712
   03036 Chromosome and associated proteins [BR:cfr03036]
    102518712
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfr04147]
    102518712
Protein phosphatases and associated proteins [BR:cfr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     102518712
Membrane trafficking [BR:cfr04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    102518712
Chromosome and associated proteins [BR:cfr03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     102518712
Exosome [BR:cfr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102518712
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 AIF-1 SPARC_Ca_bdg EH Dockerin_1 DUF5580_M SurA_N_3 FCaBP_EF-hand SurA_N_2 EF-hand_11 EF_EFCAB10_C
Other DBs
NCBI-GeneID: 102518712
NCBI-ProteinID: XP_014420662
UniProt: A0A8B7KEI9
LinkDB
Position
35:complement(2998063..2998978)
AA seq 148 aa
MAEQLSEEQVAEFKMAFDSVDKNRDGVVNVEELGAVMRALDQAPSEAMLKEFISQMDTDG
DSAINFQEFLVAMAKMKALGGKGHLREAFRAFDLDGNGRISLDELKQATAKLGVTLSPEE
LDVMIREADVDQDGQVDYEEFLHILAQK
NT seq 447 nt   +upstreamnt  +downstreamnt
atggccgagcagctgtccgaggagcaggtggccgagttcaagatggcctttgacagtgtt
gacaagaacagggacggtgtcgtcaacgtggaggagctgggcgccgtgatgcgggccctg
gaccaggccccgtcagaggccatgctgaaggagttcatctcccagatggacacggacggg
gacagcgccatcaacttccaggagttcctggtggcgatggccaagatgaaggccttgggc
ggcaagggccacctgcgggaggccttccgcgcctttgacctggatggcaacggccgcatc
agcttggacgagctcaagcaggccacggccaagcttggggtgacgctttccccggaggag
ctggacgtcatgatccgggaggccgacgtggaccaagatgggcaggtggactatgaggag
ttcctgcacatcctggcccagaagtga

DBGET integrated database retrieval system