Camelus ferus (Wild Bactrian camel): 102518712 Help Entry 102518712         CDS       T02979                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04014   Ras signaling pathway cfr04015   Rap1 signaling pathway cfr04020   Calcium signaling pathway cfr04022   cGMP-PKG signaling pathway cfr04024   cAMP signaling pathway cfr04070   Phosphatidylinositol signaling system cfr04114   Oocyte meiosis cfr04218   Cellular senescence cfr04261   Adrenergic signaling in cardiomyocytes cfr04270   Vascular smooth muscle contraction cfr04371   Apelin signaling pathway cfr04625   C-type lectin receptor signaling pathway cfr04713   Circadian entrainment cfr04720   Long-term potentiation cfr04722   Neurotrophin signaling pathway cfr04728   Dopaminergic synapse cfr04740   Olfactory transduction cfr04744   Phototransduction cfr04750   Inflammatory mediator regulation of TRP channels cfr04910   Insulin signaling pathway cfr04912   GnRH signaling pathway cfr04915   Estrogen signaling pathway cfr04916   Melanogenesis cfr04921   Oxytocin signaling pathway cfr04922   Glucagon signaling pathway cfr04924   Renin secretion cfr04925   Aldosterone synthesis and secretion cfr04970   Salivary secretion cfr04971   Gastric acid secretion cfr05010   Alzheimer disease cfr05012   Parkinson disease cfr05022   Pathways of neurodegeneration - multiple diseases cfr05031   Amphetamine addiction cfr05034   Alcoholism cfr05133   Pertussis cfr05152   Tuberculosis cfr05163   Human cytomegalovirus infection cfr05167   Kaposi sarcoma-associated herpesvirus infection cfr05170   Human immunodeficiency virus 1 infection cfr05200   Pathways in cancer cfr05214   Glioma cfr05417   Lipid and atherosclerosis cfr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102518712    04015 Rap1 signaling pathway     102518712    04070 Phosphatidylinositol signaling system     102518712    04024 cAMP signaling pathway     102518712    04022 cGMP-PKG signaling pathway     102518712  09150 Organismal Systems   09152 Endocrine system    04922 Glucagon signaling pathway     102518712    04915 Estrogen signaling pathway     102518712    04921 Oxytocin signaling pathway     102518712    04924 Renin secretion     102518712    04925 Aldosterone synthesis and secretion     102518712   09154 Digestive system    04970 Salivary secretion     102518712    04971 Gastric acid secretion     102518712   09156 Nervous system    04728 Dopaminergic synapse     102518712    04720 Long-term potentiation     102518712    04722 Neurotrophin signaling pathway     102518712   09157 Sensory system    04740 Olfactory transduction     102518712    04750 Inflammatory mediator regulation of TRP channels     102518712   09159 Environmental adaptation    04713 Circadian entrainment     102518712  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102518712   09162 Cancer: specific types    05214 Glioma     102518712   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102518712    05163 Human cytomegalovirus infection     102518712    05167 Kaposi sarcoma-associated herpesvirus infection     102518712   09171 Infectious disease: bacterial    05133 Pertussis     102518712    05152 Tuberculosis     102518712   09164 Neurodegenerative disease    05010 Alzheimer disease     102518712    05012 Parkinson disease     102518712    05022 Pathways of neurodegeneration - multiple diseases     102518712   09165 Substance dependence    05031 Amphetamine addiction     102518712    05034 Alcoholism     102518712   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102518712    05418 Fluid shear stress and atherosclerosis     102518712  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cfr01009]     102518712   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfr04131]     102518712    03036 Chromosome and associated proteins [BR:cfr03036]     102518712   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfr04147]     102518712 Protein phosphatases and associated proteins [BR:cfr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102518712 Membrane trafficking [BR:cfr04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     102518712 Chromosome and associated proteins [BR:cfr03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      102518712 Exosome [BR:cfr04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102518712 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 AIF-1 SPARC_Ca_bdg EH Dockerin_1 DUF5580_M SurA_N_3 FCaBP_EF-hand SurA_N_2 EF-hand_11 EF_EFCAB10_C Motif Other DBs NCBI-GeneID:  102518712 NCBI-ProteinID:  XP_014420662 UniProt:  A0A8B7KEI9 LinkDB All DBs Position 35:complement(2998063..2998978) Genome browser AA seq 148 aa AA seqDB search MAEQLSEEQVAEFKMAFDSVDKNRDGVVNVEELGAVMRALDQAPSEAMLKEFISQMDTDG DSAINFQEFLVAMAKMKALGGKGHLREAFRAFDLDGNGRISLDELKQATAKLGVTLSPEE LDVMIREADVDQDGQVDYEEFLHILAQK NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggccgagcagctgtccgaggagcaggtggccgagttcaagatggcctttgacagtgtt gacaagaacagggacggtgtcgtcaacgtggaggagctgggcgccgtgatgcgggccctg gaccaggccccgtcagaggccatgctgaaggagttcatctcccagatggacacggacggg gacagcgccatcaacttccaggagttcctggtggcgatggccaagatgaaggccttgggc ggcaagggccacctgcgggaggccttccgcgcctttgacctggatggcaacggccgcatc agcttggacgagctcaagcaggccacggccaagcttggggtgacgctttccccggaggag ctggacgtcatgatccgggaggccgacgtggaccaagatgggcaggtggactatgaggag ttcctgcacatcctggcccagaagtga

DBGET integrated database retrieval system