Camelus ferus (Wild Bactrian camel): 102521486 Help Entry 102521486         CDS       T02979                                  Symbol CCK Name (RefSeq) cholecystokinin   KO K05226   cholecystokinin Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04080   Neuroactive ligand-receptor interaction cfr04081   Hormone signaling cfr04911   Insulin secretion cfr04972   Pancreatic secretion Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102521486 (CCK)    04081 Hormone signaling     102521486 (CCK)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     102521486 (CCK)   09154 Digestive system    04972 Pancreatic secretion     102521486 (CCK)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfr04052]     102521486 (CCK) Cytokines and neuropeptides [BR:cfr04052]  Neuropeptides   GPCR binding    102521486 (CCK) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  102521486 NCBI-ProteinID:  XP_006181385 UniProt:  S9WZ08 LinkDB All DBs Position 17:39715727..39817372 Genome browser AA seq 115 aa AA seqDB search MNSGLCLCVLMAVLAAGALAKPVPPADPTGSRAQQEEGAPRRQLRAVQRVDEEPRAHLGA LLARYIQQARKAPSGRMSVIKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYAS NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgaacagcggcttgtgcctgtgcgtgctgatggcggtcctggcggcgggcgccctggcg aagcccgtgcctcccgcggaccccacgggctcccgggctcagcaggaggagggggcgccc cgaaggcagctgagggcggtgcagagggtggacgaggagccccgagcgcacctgggcgct ctgctggccaggtacatccagcaggctcggaaagctccctctggccgaatgtctgtgatt aagaacctgcagaacctggaccccagccacaggataagcgatcgggactacatgggctgg atggattttggccggcgcagcgctgaggagtacgagtacgcctcctag

DBGET integrated database retrieval system