KEGG   Camelus ferus (Wild Bactrian camel): 102521659
Entry
102521659         CDS       T02979                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr01524  Platinum drug resistance
cfr04010  MAPK signaling pathway
cfr04012  ErbB signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04022  cGMP-PKG signaling pathway
cfr04024  cAMP signaling pathway
cfr04062  Chemokine signaling pathway
cfr04066  HIF-1 signaling pathway
cfr04068  FoxO signaling pathway
cfr04071  Sphingolipid signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04114  Oocyte meiosis
cfr04140  Autophagy - animal
cfr04148  Efferocytosis
cfr04150  mTOR signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04210  Apoptosis
cfr04218  Cellular senescence
cfr04261  Adrenergic signaling in cardiomyocytes
cfr04270  Vascular smooth muscle contraction
cfr04350  TGF-beta signaling pathway
cfr04360  Axon guidance
cfr04370  VEGF signaling pathway
cfr04371  Apelin signaling pathway
cfr04380  Osteoclast differentiation
cfr04510  Focal adhesion
cfr04517  IgSF CAM signaling
cfr04520  Adherens junction
cfr04540  Gap junction
cfr04550  Signaling pathways regulating pluripotency of stem cells
cfr04611  Platelet activation
cfr04613  Neutrophil extracellular trap formation
cfr04620  Toll-like receptor signaling pathway
cfr04621  NOD-like receptor signaling pathway
cfr04625  C-type lectin receptor signaling pathway
cfr04650  Natural killer cell mediated cytotoxicity
cfr04657  IL-17 signaling pathway
cfr04658  Th1 and Th2 cell differentiation
cfr04659  Th17 cell differentiation
cfr04660  T cell receptor signaling pathway
cfr04662  B cell receptor signaling pathway
cfr04664  Fc epsilon RI signaling pathway
cfr04666  Fc gamma R-mediated phagocytosis
cfr04668  TNF signaling pathway
cfr04713  Circadian entrainment
cfr04720  Long-term potentiation
cfr04722  Neurotrophin signaling pathway
cfr04723  Retrograde endocannabinoid signaling
cfr04724  Glutamatergic synapse
cfr04725  Cholinergic synapse
cfr04726  Serotonergic synapse
cfr04730  Long-term depression
cfr04810  Regulation of actin cytoskeleton
cfr04910  Insulin signaling pathway
cfr04912  GnRH signaling pathway
cfr04914  Progesterone-mediated oocyte maturation
cfr04915  Estrogen signaling pathway
cfr04916  Melanogenesis
cfr04917  Prolactin signaling pathway
cfr04919  Thyroid hormone signaling pathway
cfr04921  Oxytocin signaling pathway
cfr04926  Relaxin signaling pathway
cfr04928  Parathyroid hormone synthesis, secretion and action
cfr04929  GnRH secretion
cfr04930  Type II diabetes mellitus
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr04934  Cushing syndrome
cfr04935  Growth hormone synthesis, secretion and action
cfr04960  Aldosterone-regulated sodium reabsorption
cfr05010  Alzheimer disease
cfr05020  Prion disease
cfr05022  Pathways of neurodegeneration - multiple diseases
cfr05034  Alcoholism
cfr05132  Salmonella infection
cfr05133  Pertussis
cfr05135  Yersinia infection
cfr05140  Leishmaniasis
cfr05142  Chagas disease
cfr05145  Toxoplasmosis
cfr05152  Tuberculosis
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05163  Human cytomegalovirus infection
cfr05164  Influenza A
cfr05165  Human papillomavirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05171  Coronavirus disease - COVID-19
cfr05200  Pathways in cancer
cfr05203  Viral carcinogenesis
cfr05205  Proteoglycans in cancer
cfr05206  MicroRNAs in cancer
cfr05207  Chemical carcinogenesis - receptor activation
cfr05208  Chemical carcinogenesis - reactive oxygen species
cfr05210  Colorectal cancer
cfr05211  Renal cell carcinoma
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05216  Thyroid cancer
cfr05218  Melanoma
cfr05219  Bladder cancer
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
cfr05230  Central carbon metabolism in cancer
cfr05231  Choline metabolism in cancer
cfr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cfr05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102521659 (MAPK3)
   04012 ErbB signaling pathway
    102521659 (MAPK3)
   04014 Ras signaling pathway
    102521659 (MAPK3)
   04015 Rap1 signaling pathway
    102521659 (MAPK3)
   04350 TGF-beta signaling pathway
    102521659 (MAPK3)
   04370 VEGF signaling pathway
    102521659 (MAPK3)
   04371 Apelin signaling pathway
    102521659 (MAPK3)
   04668 TNF signaling pathway
    102521659 (MAPK3)
   04066 HIF-1 signaling pathway
    102521659 (MAPK3)
   04068 FoxO signaling pathway
    102521659 (MAPK3)
   04072 Phospholipase D signaling pathway
    102521659 (MAPK3)
   04071 Sphingolipid signaling pathway
    102521659 (MAPK3)
   04024 cAMP signaling pathway
    102521659 (MAPK3)
   04022 cGMP-PKG signaling pathway
    102521659 (MAPK3)
   04151 PI3K-Akt signaling pathway
    102521659 (MAPK3)
   04150 mTOR signaling pathway
    102521659 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    102521659 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102521659 (MAPK3)
   04148 Efferocytosis
    102521659 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102521659 (MAPK3)
   04210 Apoptosis
    102521659 (MAPK3)
   04218 Cellular senescence
    102521659 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102521659 (MAPK3)
   04520 Adherens junction
    102521659 (MAPK3)
   04540 Gap junction
    102521659 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    102521659 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102521659 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102521659 (MAPK3)
   04613 Neutrophil extracellular trap formation
    102521659 (MAPK3)
   04620 Toll-like receptor signaling pathway
    102521659 (MAPK3)
   04621 NOD-like receptor signaling pathway
    102521659 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    102521659 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    102521659 (MAPK3)
   04660 T cell receptor signaling pathway
    102521659 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    102521659 (MAPK3)
   04659 Th17 cell differentiation
    102521659 (MAPK3)
   04657 IL-17 signaling pathway
    102521659 (MAPK3)
   04662 B cell receptor signaling pathway
    102521659 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    102521659 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    102521659 (MAPK3)
   04062 Chemokine signaling pathway
    102521659 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102521659 (MAPK3)
   04929 GnRH secretion
    102521659 (MAPK3)
   04912 GnRH signaling pathway
    102521659 (MAPK3)
   04915 Estrogen signaling pathway
    102521659 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    102521659 (MAPK3)
   04917 Prolactin signaling pathway
    102521659 (MAPK3)
   04921 Oxytocin signaling pathway
    102521659 (MAPK3)
   04926 Relaxin signaling pathway
    102521659 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    102521659 (MAPK3)
   04919 Thyroid hormone signaling pathway
    102521659 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    102521659 (MAPK3)
   04916 Melanogenesis
    102521659 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102521659 (MAPK3)
   04270 Vascular smooth muscle contraction
    102521659 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102521659 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    102521659 (MAPK3)
   04725 Cholinergic synapse
    102521659 (MAPK3)
   04726 Serotonergic synapse
    102521659 (MAPK3)
   04720 Long-term potentiation
    102521659 (MAPK3)
   04730 Long-term depression
    102521659 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    102521659 (MAPK3)
   04722 Neurotrophin signaling pathway
    102521659 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    102521659 (MAPK3)
   04380 Osteoclast differentiation
    102521659 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102521659 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102521659 (MAPK3)
   05206 MicroRNAs in cancer
    102521659 (MAPK3)
   05205 Proteoglycans in cancer
    102521659 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    102521659 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    102521659 (MAPK3)
   05203 Viral carcinogenesis
    102521659 (MAPK3)
   05230 Central carbon metabolism in cancer
    102521659 (MAPK3)
   05231 Choline metabolism in cancer
    102521659 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102521659 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102521659 (MAPK3)
   05212 Pancreatic cancer
    102521659 (MAPK3)
   05225 Hepatocellular carcinoma
    102521659 (MAPK3)
   05226 Gastric cancer
    102521659 (MAPK3)
   05214 Glioma
    102521659 (MAPK3)
   05216 Thyroid cancer
    102521659 (MAPK3)
   05221 Acute myeloid leukemia
    102521659 (MAPK3)
   05220 Chronic myeloid leukemia
    102521659 (MAPK3)
   05218 Melanoma
    102521659 (MAPK3)
   05211 Renal cell carcinoma
    102521659 (MAPK3)
   05219 Bladder cancer
    102521659 (MAPK3)
   05215 Prostate cancer
    102521659 (MAPK3)
   05213 Endometrial cancer
    102521659 (MAPK3)
   05224 Breast cancer
    102521659 (MAPK3)
   05223 Non-small cell lung cancer
    102521659 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102521659 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    102521659 (MAPK3)
   05161 Hepatitis B
    102521659 (MAPK3)
   05160 Hepatitis C
    102521659 (MAPK3)
   05171 Coronavirus disease - COVID-19
    102521659 (MAPK3)
   05164 Influenza A
    102521659 (MAPK3)
   05163 Human cytomegalovirus infection
    102521659 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102521659 (MAPK3)
   05165 Human papillomavirus infection
    102521659 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102521659 (MAPK3)
   05135 Yersinia infection
    102521659 (MAPK3)
   05133 Pertussis
    102521659 (MAPK3)
   05152 Tuberculosis
    102521659 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102521659 (MAPK3)
   05140 Leishmaniasis
    102521659 (MAPK3)
   05142 Chagas disease
    102521659 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102521659 (MAPK3)
   05020 Prion disease
    102521659 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    102521659 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    102521659 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102521659 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102521659 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102521659 (MAPK3)
   04934 Cushing syndrome
    102521659 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102521659 (MAPK3)
   01524 Platinum drug resistance
    102521659 (MAPK3)
   01522 Endocrine resistance
    102521659 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102521659 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfr03036]
    102521659 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfr04147]
    102521659 (MAPK3)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102521659 (MAPK3)
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102521659 (MAPK3)
Chromosome and associated proteins [BR:cfr03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     102521659 (MAPK3)
Exosome [BR:cfr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102521659 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 102521659
NCBI-ProteinID: XP_032316413
UniProt: A0A8B8REM0
LinkDB
Position
18:complement(19052743..19059320)
AA seq 379 aa
MAAATAQGGGGGEPQGADGVGPGVPGEVEIVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPTKTKVAWTKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERL
KELIFQETARFQPGVLEGP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcggcggcgacggctcaggggggcgggggcggggagccccagggagctgatggggtc
ggcccgggggtcccgggggaagtggagatagtgaagggtcagccgttcgacgtgggcccg
cgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcagcttac
gaccacgtgcgcaagactcgagtggccatcaagaaaatcagcccctttgagcatcagacc
tactgccagcgtaccttgcgggagatccagatcttgctgcgcttccgccatgagaacgtc
attggcatccgagacattctgcgggcacccaccctggaagccatgagggatgtctacatt
gtgcaggacctgatggagacagacctgtacaagttgctcaaaagccagcagctgagcaat
gaccacgtctgctacttcctctaccagatcctgcgaggcctcaagtatatccattcagcc
aacgtgctccaccgggacttaaagccctccaacctgctcatcaacaccacctgcgacctt
aagatctgtgattttggccttgcccggatcgctgatcctgagcacgaccacactggcttc
ctgacggaatacgtggccacacgctggtaccgggccccagagatcatgcttaactccaag
ggctacaccaagtccatcgatatctggtctgtgggctgcattctggctgagatgctctcc
aaccggcccatcttccctggcaagcactacctggaccagctgaaccacattctgggtatc
ctgggctccccatcccaggaggacctgaattgtatcatcaacatgaaggcccgaaactac
ctacagtctctgcccaccaagaccaaggtggcctggaccaagcttttccccaagtcggac
tccaaagctcttgacctgctggaccgcatgttgacctttaaccccaacaaacggatcaca
gtggaagaagctctggctcacccctacctggagcagtactacgacccaacagatgagcca
gtggccgaggaacctttcaccttcgacatggagctggatgatctacccaaggagcggctg
aaggagctcatcttccaggagacagcccgcttccagcctggggtgctggagggcccctaa

DBGET integrated database retrieval system